Details of the Target

General Information of Target

Target ID LDTP10411
Target Name Protein phosphatase 1 regulatory subunit 16A (PPP1R16A)
Gene Name PPP1R16A
Gene ID 84988
Synonyms
MYPT3; Protein phosphatase 1 regulatory subunit 16A; Myosin phosphatase-targeting subunit 3
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGERLLESKKDHQHGEILTQVPDDMLKKKTPRVKSCGEVSVGHASLNRHHRADTGHKPYE
YQEYGQKPYKCTYCKKAFSDLPYFRTHEWAHTGGKPYDCEECGKSFISRSSIRRHRIMHS
GDGPYKCNFCGKALMCLSLYLIHKRTHTGEKPYECKQCGKAFSHSGSLRIHERTHTGEKP
YECSECGKAFHSSTCLHAHKITHTGEKPYECKQCGKAFVSFNSVRYHERTHTGEKPYECK
QCGKAFRSASHLRTHGRTHTGEKPYECKQCGKAFGCASSVKIHERTHTGEKPCSSNTSKG
QGEKIA
Target Bioclass
Other
Subcellular location
Cell membrane
Function Inhibits protein phosphatase 1 activity toward phosphorylase, myosin light chain and myosin substrates.
Uniprot ID
Q96I34
Ensemble ID
ENST00000292539.8
HGNC ID
HGNC:14941

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K28(4.02)  LDD0277  [1]
DBIA
 Probe Info  		C497(1.03)  LDD1492  [2]
IPM
 Probe Info  		N.A.  LDD0025  [3]
NAIA_4
 Probe Info  		N.A.  LDD2226  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 HEK-293T C497(1.03)  LDD1492  [2]
 LDCM0023  KB03 HEK-293T C497(1.12)  LDD1497  [2]
 LDCM0024  KB05 HEK-293T C497(1.05)  LDD1502  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 14 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 5'-AMP-activated protein kinase beta subunit family O43741
Adenine nucleotide translocase lysine N-methyltransferase (ANTKMT) ANT/ATPSC lysine N-methyltransferase family Q9BQD7
Creatine kinase U-type, mitochondrial (CKMT1A; CKMT1B) ATP:guanido phosphotransferase family P12532
Histone-lysine N-methyltransferase SUV39H1 (SUV39H1) Histone-lysine methyltransferase family O43463
NADH dehydrogenase flavoprotein 2, mitochondrial (NDUFV2) Complex I 24 kDa subunit family P19404
Histone acetyltransferase KAT5 (KAT5) MYST (SAS/MOZ) family Q92993
Nitric oxide synthase 3 (NOS3) NOS family P29474
Mitochondrial inner membrane protease ATP23 homolog (ATP23) Peptidase M76 family Q9Y6H3
Tripeptidyl-peptidase 2 (TPP2) Peptidase S8 family P29144
Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB) PPP phosphatase family P62140
Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PPP1CC) PPP phosphatase family P36873
Testis-specific serine/threonine-protein kinase 3 (TSSK3) CAMK Ser/Thr protein kinase family Q96PN8
Fibroblast growth factor receptor 3 (FGFR3) Tyr protein kinase family P22607
GTPase HRas (HRAS) Ras family P01112
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Junctophilin-3 (JPH3) Junctophilin family Q8WXH2
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Basic leucine zipper transcriptional factor ATF-like 2 (BATF2) BZIP family Q8N1L9
Zinc finger protein 414 (ZNF414) Krueppel C2H2-type zinc-finger protein family Q96IQ9
Other
Click To Hide/Show 17 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Acyl carrier protein, mitochondrial (NDUFAB1) Acyl carrier protein (ACP) family O14561
Large ribosomal subunit protein bL12m (MRPL12) Bacterial ribosomal protein bL12 family P52815
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Keratin-associated protein 19-5 (KRTAP19-5) KRTAP type 19 family Q3LI72
U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31) PRP31 family Q8WWY3
Poly(U)-binding-splicing factor PUF60 (PUF60) RRM half pint family Q9UHX1
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
Gelsolin (GSN) Villin/gelsolin family P06396
TLE family member 5 (TLE5) WD repeat Groucho/TLE family Q08117
Thyroid receptor-interacting protein 6 (TRIP6) Zyxin/ajuba family Q15654
Arginine vasopressin-induced protein 1 (AVPI1) . Q5T686
Cell division cycle-associated 7-like protein (CDCA7L) . Q96GN5
Coiled-coil domain-containing protein 116 (CCDC116) . Q8IYX3
Mitochondrial coiled-coil domain protein 1 (MCCD1) . P59942
Nuclear transport factor 2 (NUTF2) . P61970
Ubiquilin-1 (UBQLN1) . Q9UMX0
Uncharacterized protein C3orf36 (C3orf36) . Q3SXR2

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
3 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
4 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264