Details of the Target
General Information of Target
| Target ID | LDTP10401 | |||||
|---|---|---|---|---|---|---|
| Target Name | Small G protein signaling modulator 3 (SGSM3) | |||||
| Gene Name | SGSM3 | |||||
| Gene ID | 27352 | |||||
| Synonyms |
MAP; RABGAPLP; RUTBC3; Small G protein signaling modulator 3; Merlin-associated protein; RUN and TBC1 domain-containing protein 3; Rab-GTPase-activating protein-like protein; RabGAPLP |
|||||
| 3D Structure | ||||||
| Sequence |
MRPLDIDEVEAPEEVEVLEPEEDFEQFLLPVINEMREDIASLIREHGRAYLRTRSKLWEM
DNMLIQIKTQVEASEESALNHVQHPSGEADERVSELCEKAEEKAKEIAKMAEMLVELVWR IERSESS |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Small G protein signaling modulator family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function | May play a cooperative role in NF2-mediated growth suppression of cells. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C505(2.54); C593(3.59) | LDD3369 | [1] | |
|
NAIA_5 Probe Info |
![]() |
C477(0.00); C9(0.00) | LDD2224 | [2] | |
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References



