Details of the Target

General Information of Target

Target ID LDTP10397
Target Name H/ACA ribonucleoprotein complex non-core subunit NAF1 (NAF1)
Gene Name NAF1
Gene ID 92345
Synonyms
H/ACA ribonucleoprotein complex non-core subunit NAF1; hNAF1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQL
PNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEE
DGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN
Target Bioclass
Other
Family
NAF1 family
Subcellular location
Cytoplasm
Function
RNA-binding protein required for the maturation of box H/ACA snoRNPs complex and ribosome biogenesis. During assembly of the H/ACA snoRNPs complex, it associates with the complex and disappears during maturation of the complex and is replaced by NOLA1/GAR1 to yield mature H/ACA snoRNPs complex. Probably competes with NOLA1/GAR1 for binding with DKC1/NOLA4.
Uniprot ID
Q96HR8
Ensemble ID
ENST00000274054.3
HGNC ID
HGNC:25126

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
LNCaP clone FGC SNV: p.P441T .
MDAMB436 SNV: p.R413G .
TE4 SNV: p.V228I .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		12.50  LDD0403  [1]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [2]
AOyne
 Probe Info  		12.40  LDD0443  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 12.50  LDD0403  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
H/ACA ribonucleoprotein complex subunit DKC1 (DKC1) Pseudouridine synthase TruB family O60832
Terminal nucleotidyltransferase 5B (TENT5B) TENT family Q96A09
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Sorting nexin-33 (SNX33) Sorting nexin family Q8WV41
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein MSX-2 (MSX2) Msh homeobox family P35548
Other
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein FAM168A (FAM168A) FAM168 family Q92567
Keratin-associated protein 19-3 (KRTAP19-3) KRTAP type 19 family Q7Z4W3
Keratin-associated protein 19-7 (KRTAP19-7) KRTAP type 19 family Q3SYF9
Keratin-associated protein 6-1 (KRTAP6-1) KRTAP type 6 family Q3LI64
Keratin-associated protein 6-2 (KRTAP6-2) KRTAP type 6 family Q3LI66
Mediator of RNA polymerase II transcription subunit 31 (MED31) Mediator complex subunit 31 family Q9Y3C7
H/ACA ribonucleoprotein complex non-core subunit NAF1 (NAF1) NAF1 family Q96HR8
RNA guanine-N7 methyltransferase activating subunit (RAMAC) RAM family Q9BTL3
DAZ-associated protein 2 (DAZAP2) . Q15038
Disabled homolog 1 (DAB1) . O75553
Elongin-A (ELOA) . Q14241
Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein (HERPUD2) . Q9BSE4
Melanoma-associated antigen D1 (MAGED1) . Q9Y5V3
RNA binding protein fox-1 homolog 2 (RBFOX2) . O43251
Vinexin (SORBS3) . O60504

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
3 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.