Details of the Target

General Information of Target

Target ID LDTP10382
Target Name Coiled-coil domain-containing protein 120 (CCDC120)
Gene Name CCDC120
Gene ID 90060
Synonyms
Coiled-coil domain-containing protein 120
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MASLSGLASALESYRGRDRLIRVLGYCCQLVGGVLVEQCPARSEVGTRLLVVSTQLSHCR
TILRLFDDLAMFVYTKQYGLGAQEEDAFVRCVSVLGNLADQLYYPCEHVAWAADARVLHV
DSSRWWTLSTTLWALSLLLGVARSLWMLLKLRQRLRSPTAPFTSPLPRGKRRAMEAQMQS
EALSLLSNLADLANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSMYQAARAGGQAEATT
P
Target Bioclass
Other
Subcellular location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole
Function
Centriolar protein required for centriole subdistal appendage assembly and microtubule anchoring in interphase cells. Together with CCDC68, cooperate with subdistal appendage components ODF2, NIN and CEP170 for hierarchical subdistal appendage assembly. Recruits NIN and CEP170 to centrosomes. Also required for neurite growth. Localizes CYTH2 to vesicles to allow its transport along neurites, and subsequent ARF6 activation and neurite growth.
Uniprot ID
Q96HB5
Ensemble ID
ENST00000496529.6
HGNC ID
HGNC:28910

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C353(2.58)  LDD3358  [1]
NAIA_5
 Probe Info  		C318(0.00); C440(0.00)  LDD2224  [2]
IPM
 Probe Info  		C594(0.00); C318(0.00)  LDD0147  [3]
TFBX
 Probe Info  		N.A.  LDD0148  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 769-P C353(2.05)  LDD2246  [1]
 LDCM0023  KB03 769-P C353(1.95)  LDD2663  [1]
 LDCM0024  KB05 NCI-H2291 C353(2.58)  LDD3358  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 13 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Putative histone-lysine N-methyltransferase PRDM6 (PRDM6) Class V-like SAM-binding methyltransferase superfamily Q9NQX0
Eukaryotic translation initiation factor 3 subunit F (EIF3F) EIF-3 subunit F family O00303
Integrator complex subunit 11 (INTS11) RNA-metabolizing metallo-beta-lactamase-like family Q5TA45
Ubiquitin thioesterase ZRANB1 (ZRANB1) Peptidase C64 family Q9UGI0
Mitochondrial inner membrane protease ATP23 homolog (ATP23) Peptidase M76 family Q9Y6H3
Group 10 secretory phospholipase A2 (PLA2G10) Phospholipase A2 family O15496
Fibroblast growth factor receptor 3 (FGFR3) Tyr protein kinase family P22607
Ras-related protein Rab-5A (RAB5A) Rab family P20339
GTPase HRas (HRAS) Ras family P01112
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
Fibronectin type III and SPRY domain-containing protein 2 (FSD2) . A1L4K1
Methyltransferase-like protein 27 (METTL27) . Q8N6F8
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Huntingtin (HTT) Huntingtin family P42858
Leucine zipper putative tumor suppressor 1 (LZTS1) LZTS family Q9Y250
Nuclear RNA export factor 1 (NXF1) NXF family Q9UBU9
Intraflagellar transport protein 88 homolog (IFT88) . Q13099
Transcription factor
Click To Hide/Show 14 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Fos-related antigen 1 (FOSL1) BZIP family P15407
Protein c-Fos (FOS) BZIP family P01100
G protein-coupled receptor associated sorting protein 3 (GPRASP3) GPRASP family Q6PI77
Zinc finger imprinted 2 (ZIM2) Krueppel C2H2-type zinc-finger protein family Q9NZV7
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein 648 (ZNF648) Krueppel C2H2-type zinc-finger protein family Q5T619
Zinc finger protein PLAGL2 (PLAGL2) Krueppel C2H2-type zinc-finger protein family Q9UPG8
POU domain class 2-associating factor 1 (POU2AF1) POU2AF family Q16633
Arginine-glutamic acid dipeptide repeats protein (RERE) . Q9P2R6
AT-rich interactive domain-containing protein 5A (ARID5A) . Q03989
Golgin-45 (BLZF1) . Q9H2G9
Homeobox protein notochord (NOTO) . A8MTQ0
Myogenin (MYOG) . P15173
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Platelet endothelial cell adhesion molecule (PECAM1) . P16284
Other
Click To Hide/Show 63 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
A-kinase anchor protein 8-like (AKAP8L) AKAP95 family Q9ULX6
Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) CALCOCO family Q13137
Cerebellar degeneration-related protein 2 (CDR2) CDR2 family Q01850
Centrosomal protein of 170 kDa (CEP170) CEP170 family Q5SW79
Cep170-like protein (CEP170P1) CEP170 family Q96L14
Cyclin-dependent kinases regulatory subunit 1 (CKS1B) CKS family P61024
Conserved oligomeric Golgi complex subunit 6 (COG6) COG6 family Q9Y2V7
Cornifelin (CNFN) Cornifelin family Q9BYD5
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
GAS2-like protein 2 (GAS2L2) GAS2 family Q8NHY3
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Homer protein homolog 3 (HOMER3) Homer family Q9NSC5
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type I cuticular Ha5 (KRT35) Intermediate filament family Q92764
Keratin, type I cuticular Ha8 (KRT38) Intermediate filament family O76015
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Lamin-B2 (LMNB2) Intermediate filament family Q03252
Peripherin (PRPH) Intermediate filament family P41219
Vimentin (VIM) Intermediate filament family P08670
Keratin-associated protein 19-1 (KRTAP19-1) KRTAP type 19 family Q8IUB9
Keratin-associated protein 6-1 (KRTAP6-1) KRTAP type 6 family Q3LI64
Keratin-associated protein 6-2 (KRTAP6-2) KRTAP type 6 family Q3LI66
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
Mediator of RNA polymerase II transcription subunit 11 (MED11) Mediator complex subunit 11 family Q9P086
Outer dense fiber protein 2 (ODF2) ODF2 family Q5BJF6
Large ribosomal subunit protein mL38 (MRPL38) Phosphatidylethanolamine-binding protein family Q96DV4
Keratin-associated protein 13-3 (KRTAP13-3) PMG family Q3SY46
Rab GTPase-binding effector protein 1 (RABEP1) Rabaptin family Q15276
RAD50-interacting protein 1 (RINT1) RINT1 family Q6NUQ1
Pre-mRNA-splicing factor SPF27 (BCAS2) SPF27 family O75934
Syntaxin-11 (STX11) Syntaxin family O75558
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9
Thyroid receptor-interacting protein 6 (TRIP6) Zyxin/ajuba family Q15654
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
AP-4 complex accessory subunit RUSC1 (RUSC1) . Q9BVN2
Centrosomal protein of 55 kDa (CEP55) . Q53EZ4
Coiled-coil domain-containing protein 102B (CCDC102B) . Q68D86
Coiled-coil domain-containing protein 13 (CCDC13) . Q8IYE1
Coiled-coil domain-containing protein 57 (CCDC57) . Q2TAC2
Cytohesin-1 (CYTH1) . Q15438
Cytohesin-2 (CYTH2) . Q99418
Cytohesin-3 (CYTH3) . O43739
Cytohesin-4 (CYTH4) . Q9UIA0
Cytoplasmic protein NCK2 (NCK2) . O43639
EF-hand domain-containing family member C2 (EFHC2) . Q5JST6
Heat shock factor 2-binding protein (HSF2BP) . O75031
Heterogeneous nuclear ribonucleoprotein H (HNRNPH1) . P31943
Interactor of HORMAD1 protein 1 (IHO1) . Q8IYA8
LIM domain transcription factor LMO4 (LMO4) . P61968
Melanoma-associated antigen D1 (MAGED1) . Q9Y5V3
Migration and invasion-inhibitory protein (MIIP) . Q5JXC2
Mirror-image polydactyly gene 1 protein (MIPOL1) . Q8TD10
Ninein (NIN) . Q8N4C6
Protein KASH5 (KASH5) . Q8N6L0
Puratrophin-1 (PLEKHG4) . Q58EX7
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00
TNF receptor-associated factor 1 (TRAF1) . Q13077
TP53-binding protein 1 (TP53BP1) . Q12888
Vinexin (SORBS3) . O60504
Zinc finger matrin-type protein 5 (ZMAT5) . Q9UDW3

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
3 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255