Details of the Target
General Information of Target
| Target ID | LDTP10364 | |||||
|---|---|---|---|---|---|---|
| Target Name | Brevican core protein (BCAN) | |||||
| Gene Name | BCAN | |||||
| Gene ID | 63827 | |||||
| Synonyms |
BEHAB; CSPG7; Brevican core protein; Brain-enriched hyaluronan-binding protein; BEHAB; Chondroitin sulfate proteoglycan 7 |
|||||
| 3D Structure | ||||||
| Sequence |
MEVDINGESRSTLTTLPFPGAEANSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNY
LVGFTTGEELLKLAQKCTGGEESKAEAMPSLRSKQLDAGLARSSRLYKTRSRYYQPYEIP AVNGRRRRRMPSSGDKCTKSLPYEPYKALHGPLPLCLLKGKRAHSKSLDYLNLDKMIKEP ADTEVLQYQLQHLTLRGDRVFARNNT |
|||||
| Target Bioclass |
Immunoglobulin
|
|||||
| Family |
Aggrecan/versican proteoglycan family
|
|||||
| Subcellular location |
Secreted; Secreted, extracellular space, extracellular matrix; Membrane; Lipid-anchor, GPI-anchor
|
|||||
| Function | May play a role in the terminally differentiating and the adult nervous system during postnatal development. Could stabilize interactions between hyaluronan (HA) and brain proteoglycans. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| A375 | SNV: p.D749E | . | |||
| AN3CA | SNV: p.A195V | . | |||
| DU145 | SNV: p.E665Ter | . | |||
| FTC133 | SNV: p.R347H | . | |||
| HCT15 | SNV: p.E378D | . | |||
| IM95 | SNV: p.R402C | . | |||
| IPC298 | SNV: p.D119N | . | |||
| JURKAT | Deletion: p.A646HfsTer210 | . | |||
| KYSE30 | SNV: p.G659E | . | |||
| KYSE410 | SNV: p.S814C | . | |||
| LS180 | SNV: p.A43V | . | |||
| MCC13 | SNV: p.G566R | . | |||
| MCC26 | SNV: p.P546L | . | |||
| MELJUSO | SNV: p.E477A | . | |||
| MEWO | SNV: p.P66Q | . | |||
| MOLT4 | SNV: p.R38C | . | |||
| NCIH1299 | SNV: p.V120G | . | |||
| NCIH1793 | SNV: p.P265Q | . | |||
| NCIH1944 | SNV: p.R605T | . | |||
| NCIH358 | SNV: p.S132L | . | |||
| NCIH716 | SNV: p.P65T | . | |||
| OVK18 | SNV: p.G51S | . | |||
| SKMEL30 | SNV: p.I182S | DBIA Probe Info | |||
| SKNSH | SNV: p.P44Q | . | |||
| SW1116 | SNV: p.E190D | . | |||
| TOV21G | SNV: p.A369T | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C352(3.32) | LDD3428 | [1] | |
Competitor(s) Related to This Target