Details of the Target
General Information of Target
| Target ID | LDTP10340 | |||||
|---|---|---|---|---|---|---|
| Target Name | Seipin (BSCL2) | |||||
| Gene Name | BSCL2 | |||||
| Gene ID | 26580 | |||||
| Synonyms |
Seipin; Bernardinelli-Seip congenital lipodystrophy type 2 protein |
|||||
| 3D Structure | ||||||
| Sequence |
MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRP
WHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFI TCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNC SVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTV AEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPY VGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATA APKPSEPQSRELSQ |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Seipin family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Plays a crucial role in the formation of lipid droplets (LDs) which are storage organelles at the center of lipid and energy homeostasis. In association with LDAF1, defines the sites of LD formation in the ER. Also required for growth and maturation of small nascent LDs into larger mature LDs. Mediates the formation and/or stabilization of endoplasmic reticulum-lipid droplets (ER-LD) contacts, facilitating protein and lipid delivery from the ER into growing LDs. Regulates the maturation of ZFYVE1-positive nascent LDs and the function of the RAB18-ZFYVE1 complex in mediating the formation of ER-LD contacts. Binds anionic phospholipids including phosphatidic acid. Plays an important role in the differentiation and development of adipocytes.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C18(2.18) | LDD3373 | [1] | |
|
IPM Probe Info |
![]() |
C395(1.24) | LDD1701 | [2] | |
|
TER-AC Probe Info |
![]() |
N.A. | LDD0426 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| COP9 signalosome complex subunit 3 (COPS3) | CSN3 family | Q9UNS2 | |||
| Calpain-10 (CAPN10) | Peptidase C2 family | Q9HC96 | |||
| Ataxin-3 (ATXN3) | . | P54252 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Optineurin (OPTN) | . | Q96CV9 | |||
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Platelet endothelial cell adhesion molecule (PECAM1) | . | P16284 | |||
Other
References



