Details of the Target
General Information of Target
| Target ID | LDTP10325 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein bicaudal D homolog 1 (BICD1) | |||||
| Gene Name | BICD1 | |||||
| Gene ID | 636 | |||||
| Synonyms |
Protein bicaudal D homolog 1; Bic-D 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MGNLFGRKKQSRVTEQDKAILQLKQQRDKLRQYQKRIAQQLERERALARQLLRDGRKERA
KLLLKKKRYQEQLLDRTENQISSLEAMVQSIEFTQIEMKVMEGLQFGNECLNKMHQVMSI EEVERILDETQEAVEYQRQIDELLAGSFTQEDEDAILEELSAITQEQIELPEVPSEPLPE KIPENVPVKARPRQAELVAAS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
BicD family
|
|||||
| Subcellular location |
Golgi apparatus
|
|||||
| Function | Regulates coat complex coatomer protein I (COPI)-independent Golgi-endoplasmic reticulum transport by recruiting the dynein-dynactin motor complex. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Probe 1 Probe Info |
 |
Y59(16.28) | LDD3495 | [1] | |
|
STPyne Probe Info |
 |
N.A. | LDD0009 | [2] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Glycogen synthase kinase-3 beta (GSK3B) | CMGC Ser/Thr protein kinase family | P49841 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Signal transducer and activator of transcription 3 (STAT3) | Transcription factor STAT family | P40763 | |||
References