Details of the Target

General Information of Target

Target ID LDTP10254
Target Name Protein YIPF6 (YIPF6)
Gene Name YIPF6
Gene ID 286451
Synonyms
Protein YIPF6; YIP1 family member 6
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREV
PAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNL
YDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRP
RIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDI
NTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE
YFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRII
QCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE
QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLG
DCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSS
PERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDL
KNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSD
SEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTD
GDDQEAINEAISVKQEVTDMNYPSNKS
Target Bioclass
Other
Family
YIP1 family
Subcellular location
Golgi apparatus membrane
Function May be required for stable YIPF1 and YIPF2 protein expression.
Uniprot ID
Q96EC8
Ensemble ID
ENST00000374622.3
HGNC ID
HGNC:28304

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
PEO1 SNV: p.P11S .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
YN-1
 Probe Info  		100.00  LDD0444  [1]
STPyne
 Probe Info  		K67(3.29); K72(3.28)  LDD0277  [2]
AOyne
 Probe Info  		14.30  LDD0443  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
Very long chain fatty acid elongase 4 (ELOVL4) ELO family Q9GZR5
Probable glutathione peroxidase 8 (GPX8) Glutathione peroxidase family Q8TED1
Peroxynitrite isomerase THAP4 (THAP4) Nitrobindin family Q8WY91
Estradiol 17-beta-dehydrogenase 11 (HSD17B11) Short-chain dehydrogenases/reductases (SDR) family Q8NBQ5
ADP-ribosylation factor-like protein 13B (ARL13B) Arf family Q3SXY8
V-type proton ATPase subunit e 1 (ATP6V0E1) V-ATPase e1/e2 subunit family O15342
E3 ubiquitin-protein ligase RNF185 (RNF185) . Q96GF1
Peptidyl-prolyl cis-trans isomerase FKBP7 (FKBP7) . Q9Y680
Transporter and channel
Click To Hide/Show 28 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Monocyte to macrophage differentiation factor (MMD) ADIPOR family Q15546
Solute carrier family 7 member 14 (SLC7A14) Cationic amino acid transporter (CAT) (TC 2.A.3.3) family Q8TBB6
Large neutral amino acids transporter small subunit 2 (SLC7A8) L-type amino acid transporter (LAT) (TC 2.A.3.8) family Q9UHI5
Sodium-coupled neutral amino acid transporter 7 (SLC38A7) Amino acid/polyamine transporter 2 family Q9NVC3
Ammonium transporter Rh type C (RHCG) Ammonium transporter family Q9UBD6
Stomatin (STOM) Band 7/mec-2 family P27105
Hepatic sodium/bile acid cotransporter (SLC10A1) Bile acid:sodium symporter (BASS) family Q14973
Sodium-dependent organic anion transporter (SLC10A6) Bile acid:sodium symporter (BASS) family Q3KNW5
Probable proton-coupled zinc antiporter SLC30A4 (SLC30A4) Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family O14863
Proton-coupled zinc antiporter SLC30A8 (SLC30A8) Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family Q8IWU4
Gap junction alpha-5 protein (GJA5) Connexin family P36382
Gap junction alpha-8 protein (GJA8) Connexin family P48165
Gap junction beta-1 protein (GJB1) Connexin family P08034
G protein-activated inward rectifier potassium channel 2 (KCNJ6) Inward rectifier-type potassium channel family P48051
Hippocampus abundant transcript-like protein 1 (MFSD14B) Major facilitator superfamily Q5SR56
Molybdate-anion transporter (MFSD5) Major facilitator superfamily Q6N075
Aquaporin-2 (AQP2) MIP/aquaporin (TC 1.A.8) family P41181
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Membrane-spanning 4-domains subfamily A member 3 (MS4A3) MS4A family Q96HJ5
Transmembrane protein 106C (TMEM106C) TMEM106 family Q9BVX2
Transmembrane protein 14B (TMEM14B) TMEM14 family Q9NUH8
Potassium channel subfamily K member 5 (KCNK5) Two pore domain potassium channel (TC 1.A.1.8) family O95279
Protein YIPF1 (YIPF1) YIP1 family Q9Y548
Protein YIPF2 (YIPF2) YIP1 family Q9BWQ6
Zinc transporter ZIP1 (SLC39A1) ZIP transporter (TC 2.A.5) family Q9NY26
Zinc transporter ZIP2 (SLC39A2) ZIP transporter (TC 2.A.5) family Q9NP94
Lymphatic vessel endothelial hyaluronic acid receptor 1 (LYVE1) . Q9Y5Y7
Thioredoxin-related transmembrane protein 2 (TMX2) . Q9Y320
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) BZIP family Q96BA8
Cyclic AMP-responsive element-binding protein 3-like protein 3 (CREB3L3) BZIP family Q68CJ9
GPCR
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cannabinoid receptor 2 (CNR2) G-protein coupled receptor 1 family P34972
Free fatty acid receptor 2 (FFAR2) G-protein coupled receptor 1 family O15552
G-protein coupled receptor 42 (GPR42) G-protein coupled receptor 1 family O15529
Probable G-protein coupled receptor 101 (GPR101) G-protein coupled receptor 1 family Q96P66
Probable G-protein coupled receptor 152 (GPR152) G-protein coupled receptor 1 family Q8TDT2
Thyrotropin-releasing hormone receptor (TRHR) G-protein coupled receptor 1 family P34981
Immunoglobulin
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
B-cell antigen receptor complex-associated protein alpha chain (CD79A) . P11912
Leucine-rich repeat-containing protein 4C (LRRC4C) . Q9HCJ2
Cytokine and receptor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Interleukin-27 receptor subunit alpha (IL27RA) Type I cytokine receptor family Q6UWB1
Interleukin-10 receptor subunit alpha (IL10RA) Type II cytokine receptor family Q13651
Other
Click To Hide/Show 23 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Apolipoprotein L2 (APOL2) Apolipoprotein L family Q9BQE5
Complex I intermediate-associated protein 30, mitochondrial (NDUFAF1) CIA30 family Q9Y375
CDGSH iron-sulfur domain-containing protein 2 (CISD2) CISD protein family Q8N5K1
Complexin-4 (CPLX4) Complexin/synaphin family Q7Z7G2
Ephrin-A5 (EFNA5) Ephrin family P52803
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Protein FAM209A (FAM209A) FAM209 family Q5JX71
Translation initiation factor IF-3, mitochondrial (MTIF3) IF-3 family Q9H2K0
Leucine-rich repeat-containing protein 3B (LRRC3B) LRRC3 family Q96PB8
UL16-binding protein 2 (ULBP2) MHC class I family Q9BZM5
UL16-binding protein 6 (RAET1L) MHC class I family Q5VY80
Reticulophagy regulator 3 (RETREG3) RETREG family Q86VR2
T-cell leukemia translocation-altered gene protein (TCTA) TCTA family P57738
Transmembrane protein 11, mitochondrial (TMEM11) TMEM11 family P17152
Golgi apparatus membrane protein TVP23 homolog B (TVP23B) TVP23 family Q9NYZ1
Cell growth regulator with RING finger domain protein 1 (CGRRF1) . Q99675
Leucine-rich repeat-containing protein 25 (LRRC25) . Q8N386
Lymphocyte antigen 6 complex locus protein G6c (LY6G6C) . O95867
Outer dense fiber protein 4 (ODF4) . Q2M2E3
PDZK1-interacting protein 1 (PDZK1IP1) . Q13113
Serine-rich single-pass membrane protein 1 (SSMEM1) . Q8WWF3
Transmembrane protein 130 (TMEM130) . Q8N3G9
Uncharacterized protein CXorf66 (CXorf66) . Q5JRM2

References

1 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.