Details of the Target
General Information of Target
Target ID | LDTP10165 | |||||
---|---|---|---|---|---|---|
Target Name | Baculoviral IAP repeat-containing protein 7 (BIRC7) | |||||
Gene Name | BIRC7 | |||||
Gene ID | 79444 | |||||
Synonyms |
KIAP; LIVIN; MLIAP; RNF50; Baculoviral IAP repeat-containing protein 7; EC 2.3.2.27; Kidney inhibitor of apoptosis protein; KIAP; Livin; Melanoma inhibitor of apoptosis protein; ML-IAP; RING finger protein 50; RING-type E3 ubiquitin transferase BIRC7) [Cleaved into: Baculoviral IAP repeat-containing protein 7 30kDa subunit; Truncated livin; p30-Livin; tLivin)]
|
|||||
3D Structure | ||||||
Sequence |
MSGYQRRPGATPLSRARSLAIPDAPAFYERRSCLPQLNCERPHGRDLDSPFFGIRPAFMC
YVPSPVLASVGDTDFGYGKGKCSKQSPSGAHGTHFGDDRFEDLEEANPFSFREFLKTKNL GLSKEDPASRIYAKEASRHSLGLDHNSPPSQTGGYGLEYQQPFFEDPTGAGDLLDEEEDE DTGWSGAYLPSAIEQTHPERVPAGTSPCSTYLSFFSTPSELAGPESLPSWALSDTDSRVS PASPAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSKLRRKLNEVQSFSEAQTEMVR TLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVVKLKQEISLLQAQVS NFQRENEALRCGQGASLTVVKQNADVALQNLRVVMNSAQASIKQLVSGAETLNLVAEILK SIDRISEVKDEEEDS |
|||||
Target Type |
Patented-recorded
|
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
IAP family
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Apoptotic regulator capable of exerting proapoptotic and anti-apoptotic activities and plays crucial roles in apoptosis, cell proliferation, and cell cycle control. Its anti-apoptotic activity is mediated through the inhibition of CASP3, CASP7 and CASP9, as well as by its E3 ubiquitin-protein ligase activity. As it is a weak caspase inhibitor, its anti-apoptotic activity is thought to be due to its ability to ubiquitinate DIABLO/SMAC targeting it for degradation thereby promoting cell survival. May contribute to caspase inhibition, by blocking the ability of DIABLO/SMAC to disrupt XIAP/BIRC4-caspase interactions. Protects against apoptosis induced by TNF or by chemical agents such as adriamycin, etoposide or staurosporine. Suppression of apoptosis is mediated by activation of MAPK8/JNK1, and possibly also of MAPK9/JNK2. This activation depends on TAB1 and MAP3K7/TAK1. In vitro, inhibits CASP3 and proteolytic activation of pro-CASP9.; [Isoform 1]: Blocks staurosporine-induced apoptosis. Promotes natural killer (NK) cell-mediated killing.; [Isoform 2]: Blocks etoposide-induced apoptosis. Protects against natural killer (NK) cell-mediated killing.
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C45(1.83) | LDD3427 | [1] |
Competitor(s) Related to This Target