Details of the Target

General Information of Target

Target ID LDTP10139
Target Name Zinc finger and BTB domain-containing protein 8A (ZBTB8A)
Gene Name ZBTB8A
Gene ID 653121
Synonyms
BOZF1; Zinc finger and BTB domain-containing protein 8A; BTB/POZ and zinc-finger domain-containing factor; BTB/POZ and zinc-finger domains factor on chromosome 1; BOZ-F1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MVSGLRLASRSGEEGWLKPAVARLGPPRHRLRNLRTESPWRSRGSVLFCSGPGRAGRAAE
PLHPVCTCGRHFRRPEPCREPLASPIQDSVAFEDVAVNFTQEEWALLDSSQKNLYREVMQ
ETCRNLASVGSQWKDQNIEDHFEKPGKDIRNHIVQRLCESKEDGQYGEVVSQIPNLDLNE
NISTGLKPCECSICGKVFVRHSLLNRHILAHSGYKPYGEKQYKCEQCGKFFVSVPGVRRH
MIMHSGNPAYKCTICGKAFYFLNSVERHQRTHTGEKPYKCKQCGKAFTVSGSCLIHERTH
TGEKPYECKECGKTFRFSCSFKTHERTHTGERPYKCTKCDKAFSCSTSLRYHGSIHTGER
PYECKQCGKAFSRLSSLCNHRSTHTGEKPYECKQCDQAFSRLSSLHLHERIHTGEKPYEC
KKCGKAYTRSSHLTRHERSHDIEAGCSDSAYNPSTLGGQGVWIA
Target Bioclass
Transcription factor
Subcellular location
Nucleus
Function May be involved in transcriptional regulation.
Uniprot ID
Q96BR9
Ensemble ID
ENST00000373510.9
HGNC ID
HGNC:24172

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HS936T SNV: p.Y48F .
OAW42 SNV: p.E430V .
RKO SNV: p.G47C .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		C336(1.56)  LDD1701  [1]
DBIA
 Probe Info  		C336(0.96)  LDD1492  [2]
IA-alkyne
 Probe Info  		N.A.  LDD0165  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0215  AC10 HEK-293T C336(1.10)  LDD1508  [2]
 LDCM0277  AC18 HEK-293T C336(0.99)  LDD1516  [2]
 LDCM0279  AC2 HEK-293T C336(1.01)  LDD1518  [2]
 LDCM0286  AC26 HEK-293T C336(1.04)  LDD1525  [2]
 LDCM0295  AC34 HEK-293T C336(1.12)  LDD1534  [2]
 LDCM0304  AC42 HEK-293T C336(1.10)  LDD1543  [2]
 LDCM0313  AC50 HEK-293T C336(1.02)  LDD1552  [2]
 LDCM0321  AC58 HEK-293T C336(1.07)  LDD1560  [2]
 LDCM0405  CL18 HEK-293T C336(1.09)  LDD1609  [2]
 LDCM0419  CL30 HEK-293T C336(1.08)  LDD1623  [2]
 LDCM0432  CL42 HEK-293T C336(1.04)  LDD1636  [2]
 LDCM0445  CL54 HEK-293T C336(1.05)  LDD1648  [2]
 LDCM0451  CL6 HEK-293T C336(1.05)  LDD1654  [2]
 LDCM0458  CL66 HEK-293T C336(1.11)  LDD1661  [2]
 LDCM0471  CL78 HEK-293T C336(1.11)  LDD1674  [2]
 LDCM0485  CL90 HEK-293T C336(1.01)  LDD1688  [2]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C336(1.04)  LDD1702  [1]
 LDCM0022  KB02 HEK-293T C336(0.96)  LDD1492  [2]
 LDCM0023  KB03 HEK-293T C336(0.99)  LDD1497  [2]
 LDCM0024  KB05 HEK-293T C336(1.02)  LDD1502  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 16 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
26S proteasome regulatory subunit 4 (PSMC1) AAA ATPase family P62191
Probable ATP-dependent RNA helicase DDX6 (DDX6) DEAD box helicase family P26196
Peroxisomal bifunctional enzyme (EHHADH) Enoyl-CoA hydratase/isomerase family; 3-hydroxyacyl-CoA dehydrogenase family Q08426
Histone acetyltransferase KAT5 (KAT5) MYST (SAS/MOZ) family Q92993
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
E3 SUMO-protein ligase PIAS2 (PIAS2) PIAS family O75928
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2) CAMK Ser/Thr protein kinase family P54646
Casein kinase I isoform delta (CSNK1D) CK1 Ser/Thr protein kinase family P48730
Cyclin-dependent kinase-like 3 (CDKL3) CMGC Ser/Thr protein kinase family Q8IVW4
Tyrosine-protein kinase Blk (BLK) Tyr protein kinase family P51451
Tyrosine-protein kinase Yes (YES1) Tyr protein kinase family P07947
Kinesin-like protein KIF9 (KIF9) Kinesin family Q9HAQ2
Kinesin-like protein KIFC3 (KIFC3) Kinesin family Q9BVG8
E3 ubiquitin-protein ligase TRIM41 (TRIM41) TRIM/RBCC family Q8WV44
Acetyl-coenzyme A thioesterase (ACOT12) . Q8WYK0
Apoptosis-enhancing nuclease (AEN) . Q8WTP8
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
AP-1 complex subunit mu-1 (AP1M1) Adaptor complexes medium subunit family Q9BXS5
Hsp90 co-chaperone Cdc37 (CDC37) CDC37 family Q16543
Kinesin-1 heavy chain (KIF5B) Kinesin family P33176
Syntenin-1 (SDCBP) . O00560
Transcription factor
Click To Hide/Show 18 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Telomere zinc finger-associated protein (ZBTB48) Krueppel C2H2-type zinc-finger protein family P10074
Zinc finger and BTB domain-containing protein 17 (ZBTB17) Krueppel C2H2-type zinc-finger protein family Q13105
Zinc finger and BTB domain-containing protein 24 (ZBTB24) Krueppel C2H2-type zinc-finger protein family O43167
Zinc finger and BTB domain-containing protein 49 (ZBTB49) Krueppel C2H2-type zinc-finger protein family Q6ZSB9
Zinc finger protein 138 (ZNF138) Krueppel C2H2-type zinc-finger protein family P52744
Zinc finger protein 329 (ZNF329) Krueppel C2H2-type zinc-finger protein family Q86UD4
Zinc finger protein 35 (ZNF35) Krueppel C2H2-type zinc-finger protein family P13682
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein 438 (ZNF438) Krueppel C2H2-type zinc-finger protein family Q7Z4V0
Zinc finger protein 497 (ZNF497) Krueppel C2H2-type zinc-finger protein family Q6ZNH5
Zinc finger protein 572 (ZNF572) Krueppel C2H2-type zinc-finger protein family Q7Z3I7
Zinc finger protein 587 (ZNF587) Krueppel C2H2-type zinc-finger protein family Q96SQ5
Zinc finger protein 648 (ZNF648) Krueppel C2H2-type zinc-finger protein family Q5T619
Zinc finger protein 837 (ZNF837) Krueppel C2H2-type zinc-finger protein family Q96EG3
Hypermethylated in cancer 2 protein (HIC2) Krueppel C2H2-type zinc-finger protein family Q96JB3
Zinc finger CCCH-type with G patch domain-containing protein (ZGPAT) . Q8N5A5
Zinc finger protein 276 (ZNF276) . Q8N554
Zinc finger protein 408 (ZNF408) . Q9H9D4
Other
Click To Hide/Show 20 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Bystin (BYSL) Bystin family Q13895
CWF19-like protein 2 (CWF19L2) CWF19 family Q2TBE0
Segment polarity protein dishevelled homolog DVL-3 (DVL3) DSH family Q92997
Probable RNA-binding protein EIF1AD (EIF1AD) EIF1AD family Q8N9N8
Armadillo repeat-containing X-linked protein 1 (ARMCX1) Eutherian X-chromosome-specific Armcx family Q9P291
Protein FAM161A (FAM161A) FAM161 family Q3B820
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
Microfibrillar-associated protein 1 (MFAP1) MFAP1 family P55081
UV excision repair protein RAD23 homolog A (RAD23A) RAD23 family P54725
Transcription elongation factor A protein 2 (TCEA2) TFS-II family Q15560
Large ribosomal subunit protein uL11m (MRPL11) Universal ribosomal protein uL11 family Q9Y3B7
Large ribosomal subunit protein uL6 (RPL9; RPL9P7; RPL9P8; RPL9P9) Universal ribosomal protein uL6 family P32969
Armadillo repeat-containing protein 7 (ARMC7) . Q9H6L4
Chromobox protein homolog 8 (CBX8) . Q9HC52
G patch domain-containing protein 2-like (GPATCH2L) . Q9NWQ4
Placental protein 13-like (LGALS14) . Q8TCE9
Proline-rich protein 34 (PRR34) . Q9NV39
TNFAIP3-interacting protein 3 (TNIP3) . Q96KP6
Zinc finger CCHC domain-containing protein 10 (ZCCHC10) . Q8TBK6
Zinc finger matrin-type protein 2 (ZMAT2) . Q96NC0

References

1 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
2 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
3 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060