Details of the Target
General Information of Target
Target ID | LDTP10126 | |||||
---|---|---|---|---|---|---|
Target Name | Solute carrier family 22 member 18 (SLC22A18) | |||||
Gene Name | SLC22A18 | |||||
Gene ID | 5002 | |||||
Synonyms |
BWR1A; BWSCR1A; HET; IMPT1; ITM; ORCTL2; SLC22A1L; TSSC5; Solute carrier family 22 member 18; Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene A protein; Efflux transporter-like protein; Imprinted multi-membrane-spanning polyspecific transporter-related protein 1; Organic cation transporter-like protein 2; ORCTL-2; Solute carrier family 22 member 1-like; Tumor-suppressing STF cDNA 5 protein; Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein; p45-Beckwith-Wiedemann region 1 A; p45-BWR1A
|
|||||
3D Structure | ||||||
Sequence |
MAASASAAAGEEDWVLPSEVEVLESIYLDELQVIKGNGRTSPWEIYITLHPATAEDQDSQ
YVCFTLVLQVPAEYPHEVPQISIRNPRGLSDEQIHTILQVLGHVAKAGLGTAMLYELIEK GKEILTDNNIPHGQCVICLYGFQEKEAFTKTPCYHYFHCHCLARYIQHMEQELKAQGQEQ EQERQHATTKQKAVGVQCPVCREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKR LYQRQQERGGIIDLEAERNRYFISLQQPPAPAEPESAVDVSKGSQPPSTLAAELSTSPAV QSTLPPPLPVATQHICEKIPGTRSNQQRLGETQKAMLDPPKPSRGPWRQPERRHPKGGEC HAPKGTRDTQELPPPEGPLKEPMDLKPEPHSQGVEGPPQEKGPGSWQGPPPRRTRDCVRW ERSKGRTPGSSYPRLPRGQGAYRPGTRRESLGLESKDGS |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
Major facilitator (TC 2.A.1) superfamily, Organic cation transporter (TC 2.A.1.19) family
|
|||||
Subcellular location |
Apical cell membrane
|
|||||
Function | May act as a transporter of organic cations based on a proton efflux antiport mechanism. May play a role in the transport of chloroquine and quinidine-related compounds in kidney. | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C369(1.85) | LDD3312 | [1] | |
TFBX Probe Info |
![]() |
N.A. | LDD0027 | [2] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Estradiol 17-beta-dehydrogenase 11 (HSD17B11) | Short-chain dehydrogenases/reductases (SDR) family | Q8NBQ5 | |||
TLC domain-containing protein 4 (TLCD4) | TLCD4 family | Q96MV1 |
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Thioredoxin-related transmembrane protein 2 (TMX2) | . | Q9Y320 |
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Homeobox protein Nkx-3.1 (NKX3-1) | NK-3 homeobox family | Q99801 |
References