Details of the Target
General Information of Target
Target ID | LDTP10120 | |||||
---|---|---|---|---|---|---|
Target Name | PHD finger protein 21A (PHF21A) | |||||
Gene Name | PHF21A | |||||
Gene ID | 51317 | |||||
Synonyms |
BHC80; KIAA1696; PHD finger protein 21A; BHC80a; BRAF35-HDAC complex protein BHC80 |
|||||
3D Structure | ||||||
Sequence |
MPLHQLGDKPLTFPSPNSAMENGLDHTPPSRRASPGTPLSPGSLRSAAHSPLDTSKQPLC
QLWAEKHGARGTHEVRYVSAGQSVACGWWAFAPPCLQVLNTPKGILFFLCAAAFLQGMTV NGFINTVITSLERRYDLHSYQSGLIASSYDIAACLCLTFVSYFGGSGHKPRWLGWGVLLM GTGSLVFALPHFTAGRYEVELDAGVRTCPANPGAVCADSTSGLSRYQLVFMLGQFLHGVG ATPLYTLGVTYLDENVKSSCSPVYIAIFYTAAILGPAAGYLIGGALLNIYTEMGRRTELT TESPLWVGAWWVGFLGSGAAAFFTAVPILGYPRQLPGSQRYAVMRAAEMHQLKDSSRGEA SNPDFGKTIRDLPLSIWLLLKNPTFILLCLAGATEATLITGMSTFSPKFLESQFSLSASE AATLFGYLVVPAGGGGTFLGGFFVNKLRLRGSAVIKFCLFCTVVSLLGILVFSLHCPSVP MAGVTASYGGSLLPEGHLNLTAPCNAACSCQPEHYSPVCGSDGLMYFSLCHAGCPAATET NVDGQKVYRDCSCIPQNLSSGFGHATAGKCTSTCQRKPLLLVFIFVVIFFTFLSSIPALT ATLRCVRDPQRSFALGIQWIVVRILGGIPGPIAFGWVIDKACLLWQDQCGQQGSCLVYQN SAMSRYILIMGLLYKVLGVLFFAIACFLYKPLSESSDGLETCLPSQSSAPDSATDSQLQS SV |
|||||
Target Bioclass |
Other
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it may act as a scaffold. Inhibits KDM1A-mediated demethylation of 'Lys-4' of histone H3 in vitro, suggesting a role in demethylation regulation.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C533(1.36) | LDD3383 | [1] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0215 | AC10 | HEK-293T | C514(0.98) | LDD1508 | [2] |
LDCM0277 | AC18 | HEK-293T | C514(0.94) | LDD1516 | [2] |
LDCM0279 | AC2 | HEK-293T | C514(1.06) | LDD1518 | [2] |
LDCM0286 | AC26 | HEK-293T | C514(0.97) | LDD1525 | [2] |
LDCM0295 | AC34 | HEK-293T | C514(0.96) | LDD1534 | [2] |
LDCM0304 | AC42 | HEK-293T | C514(0.93) | LDD1543 | [2] |
LDCM0313 | AC50 | HEK-293T | C514(0.97) | LDD1552 | [2] |
LDCM0321 | AC58 | HEK-293T | C514(1.03) | LDD1560 | [2] |
LDCM0371 | CL102 | HEK-293T | C532(0.85) | LDD1575 | [2] |
LDCM0375 | CL106 | HEK-293T | C532(1.05) | LDD1579 | [2] |
LDCM0380 | CL110 | HEK-293T | C532(0.90) | LDD1584 | [2] |
LDCM0384 | CL114 | HEK-293T | C532(0.85) | LDD1588 | [2] |
LDCM0388 | CL118 | HEK-293T | C532(1.12) | LDD1592 | [2] |
LDCM0393 | CL122 | HEK-293T | C532(1.06) | LDD1597 | [2] |
LDCM0397 | CL126 | HEK-293T | C532(1.01) | LDD1601 | [2] |
LDCM0401 | CL14 | HEK-293T | C532(0.96) | LDD1605 | [2] |
LDCM0405 | CL18 | HEK-293T | C514(0.99) | LDD1609 | [2] |
LDCM0407 | CL2 | HEK-293T | C532(0.93) | LDD1611 | [2] |
LDCM0414 | CL26 | HEK-293T | C532(1.18) | LDD1618 | [2] |
LDCM0419 | CL30 | HEK-293T | C514(0.98) | LDD1623 | [2] |
LDCM0432 | CL42 | HEK-293T | C514(1.02) | LDD1636 | [2] |
LDCM0441 | CL50 | HEK-293T | C532(1.25) | LDD1645 | [2] |
LDCM0445 | CL54 | HEK-293T | C514(0.86) | LDD1648 | [2] |
LDCM0451 | CL6 | HEK-293T | C514(0.91) | LDD1654 | [2] |
LDCM0454 | CL62 | HEK-293T | C532(1.08) | LDD1657 | [2] |
LDCM0458 | CL66 | HEK-293T | C514(1.01) | LDD1661 | [2] |
LDCM0467 | CL74 | HEK-293T | C532(0.97) | LDD1670 | [2] |
LDCM0471 | CL78 | HEK-293T | C514(1.05) | LDD1674 | [2] |
LDCM0480 | CL86 | HEK-293T | C532(1.08) | LDD1683 | [2] |
LDCM0485 | CL90 | HEK-293T | C514(0.82) | LDD1688 | [2] |
LDCM0493 | CL98 | HEK-293T | C532(0.84) | LDD1696 | [2] |
LDCM0427 | Fragment51 | HEK-293T | C532(1.23) | LDD1631 | [2] |
LDCM0022 | KB02 | A2780 | C533(1.05) | LDD2254 | [1] |
LDCM0023 | KB03 | A2780 | C533(1.01); C515(1.44) | LDD2671 | [1] |
LDCM0024 | KB05 | OVCAR-5 | C533(1.36) | LDD3383 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Exosome complex component RRP43 (EXOSC8) | RNase PH family | Q96B26 |
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Nuclear pore glycoprotein p62 (NUP62) | Nucleoporin NSP1/NUP62 family | P37198 |
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Transcription factor Sp3 (SP3) | Sp1 C2H2-type zinc-finger protein family | Q02447 |
Other
References