Details of the Target

General Information of Target

Target ID LDTP10114
Target Name Arrestin domain-containing protein 3 (ARRDC3)
Gene Name ARRDC3
Gene ID 57561
Synonyms
KIAA1376; Arrestin domain-containing protein 3; TBP-2-like inducible membrane protein; TLIMP
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLAR
NLSDIDLMAPQPGV
Target Bioclass
Transporter and channel
Family
Arrestin family
Subcellular location
Cytoplasm
Function
Adapter protein that plays a role in regulating cell-surface expression of adrenergic receptors and probably also other G protein-coupled receptors. Plays a role in NEDD4-mediated ubiquitination and endocytosis af activated ADRB2 and subsequent ADRB2 degradation. May recruit NEDD4 to ADRB2. Alternatively, may function as adapter protein that does not play a major role in recruiting NEDD4 to ADRB2, but rather plays a role in a targeting ADRB2 to endosomes.
Uniprot ID
Q96B67
Ensemble ID
ENST00000265138.4
HGNC ID
HGNC:29263

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
NAIA_4
 Probe Info  		N.A.  LDD2226  [1]
TFBX
 Probe Info  		N.A.  LDD0148  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 17 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cytidine deaminase (CDA) Cytidine and deoxycytidylate deaminase family P32320
Hematopoietic prostaglandin D synthase (HPGDS) Sigma family O60760
Tumor necrosis factor alpha-induced protein 3 (TNFAIP3) Peptidase C64 family P21580
Ubiquitin thioesterase ZRANB1 (ZRANB1) Peptidase C64 family Q9UGI0
Ubiquitin thioesterase OTUB2 (OTUB2) Peptidase C65 family Q96DC9
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2) CAMK Ser/Thr protein kinase family P54646
E3 ubiquitin-protein ligase RAD18 (RAD18) RAD18 family Q9NS91
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
Ubiquitin-conjugating enzyme E2 D1 (UBE2D1) Ubiquitin-conjugating enzyme family P51668
Ubiquitin-conjugating enzyme E2 D2 (UBE2D2) Ubiquitin-conjugating enzyme family P62837
Ubiquitin-conjugating enzyme E2 E2 (UBE2E2) Ubiquitin-conjugating enzyme family Q96LR5
Ubiquitin-conjugating enzyme E2 E3 (UBE2E3) Ubiquitin-conjugating enzyme family Q969T4
DCN1-like protein 1 (DCUN1D1) . Q96GG9
E3 ubiquitin-protein ligase Itchy homolog (ITCH) . Q96J02
E3 ubiquitin-protein ligase NEDD4 (NEDD4) . P46934
NEDD4-like E3 ubiquitin-protein ligase WWP1 (WWP1) . Q9H0M0
NEDD4-like E3 ubiquitin-protein ligase WWP2 (WWP2) . O00308
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Small ribosomal subunit protein RACK1 (RACK1) WD repeat G protein beta family P63244
Optineurin (OPTN) . Q96CV9
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
PHD finger protein 1 (PHF1) Polycomblike family O43189
B-cell lymphoma 6 protein (BCL6) . P41182
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Beta-2 adrenergic receptor (ADRB2) G-protein coupled receptor 1 family P07550
Other
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
EGF-containing fibulin-like extracellular matrix protein 2 (EFEMP2) Fibulin family O95967
Integrin beta-4 (ITGB4) Integrin beta chain family P16144
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (SMARCD1) SMARCD family Q96GM5
Signal transducing adapter molecule 2 (STAM2) STAM family O75886
Toll-interacting protein (TOLLIP) Tollip family Q9H0E2
Ubiquitin-ribosomal protein eL40 fusion protein (UBA52) Ubiquitin family; Eukaryotic ribosomal protein eL40 family P62987
BAG family molecular chaperone regulator 3 (BAG3) . O95817
Coiled-coil domain-containing protein 50 (CCDC50) . Q8IVM0
Mortality factor 4-like protein 1 (MORF4L1) . Q9UBU8
Ubiquilin-2 (UBQLN2) . Q9UHD9
Ubiquitin-associated domain-containing protein 1 (UBAC1) . Q9BSL1

References

1 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
2 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255