Details of the Target
General Information of Target
| Target ID | LDTP10107 | |||||
|---|---|---|---|---|---|---|
| Target Name | Dapper homolog 3 (DACT3) | |||||
| Gene Name | DACT3 | |||||
| Gene ID | 147906 | |||||
| Synonyms |
RRR1; Dapper homolog 3; Antagonist of beta-catenin Dapper homolog 3; Arginine-rich region 1 protein; Dapper antagonist of catenin 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKF
SSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCK EKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Dapper family
|
|||||
| Function |
May be involved in regulation of intracellular signaling pathways during development. Specifically thought to play a role in canonical and/or non-canonical Wnt signaling pathways through interaction with DSH (Dishevelled) family proteins.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C473(4.18) | LDD3433 | [1] | |
|
IPM Probe Info |
 |
N.A. | LDD2156 | [2] | |
Competitor(s) Related to This Target
References