Details of the Target
General Information of Target
| Target ID | LDTP10053 | |||||
|---|---|---|---|---|---|---|
| Target Name | Terminal nucleotidyltransferase 5B (TENT5B) | |||||
| Gene Name | TENT5B | |||||
| Gene ID | 115572 | |||||
| Synonyms |
FAM46B; Terminal nucleotidyltransferase 5B; EC 2.7.7.19; Non-canonical poly(A) polymerase FAM46B |
|||||
| 3D Structure | ||||||
| Sequence |
MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
TENT family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Catalyzes the transfer of one adenosine molecule from an ATP to an mRNA poly(A) tail bearing a 3'-OH terminal group in an ATP hydrolysis-dependent manner. May be involved in maintaining the translation efficiency of at least some genes through preventing degradation of their mRNAs. Prefers RNA molecules that are adenosine-rich close to 3'-end. In addition, may inhibit cell proliferation and cell cycle progression through ubiquitination of beta-catenin/CTNNB1.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
C283(0.70) | LDD2207 | [1] | |
Competitor(s) Related to This Target