Details of the Target
General Information of Target
Target ID | LDTP09997 | |||||
---|---|---|---|---|---|---|
Target Name | Caveolae-associated protein 3 (CAVIN3) | |||||
Gene Name | CAVIN3 | |||||
Gene ID | 112464 | |||||
Synonyms |
PRKCDBP; SRBC; Caveolae-associated protein 3; Cavin-3; Protein kinase C delta-binding protein; Serum deprivation response factor-related gene product that binds to C-kinase; hSRBC |
|||||
3D Structure | ||||||
Sequence |
MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIP
KPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYE AEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPD DYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRK LEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQ EEREKEAAEQAERSQSSIVPEEEQAANKGEEKKDDENIPMETEETHLEETTESQQNGEEG TSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEKKE |
|||||
Target Bioclass |
Other
|
|||||
Family |
CAVIN family
|
|||||
Subcellular location |
Cytoplasm
|
|||||
Function |
Regulates the traffic and/or budding of caveolae. Plays a role in caveola formation in a tissue-specific manner. Required for the formation of caveolae in smooth muscle but not in the lung and heart endothelial cells. Regulates the equilibrium between cell surface-associated and cell surface-dissociated caveolae by promoting the rapid release of caveolae from the cell surface. Plays a role in the regulation of the circadian clock. Modulates the period length and phase of circadian gene expression and also regulates expression and interaction of the core clock components PER1/2 and CRY1/2.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
ONAyne Probe Info |
![]() |
K185(3.58) | LDD0274 | [1] | |
STPyne Probe Info |
![]() |
K185(10.00); K197(10.00); K208(10.00); K84(8.79) | LDD0277 | [1] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0223 | [2] | |
5E-2FA Probe Info |
![]() |
H113(0.00); H91(0.00) | LDD2235 | [3] | |
m-APA Probe Info |
![]() |
H91(0.00); H71(0.00) | LDD2231 | [3] | |
Crotonaldehyde Probe Info |
![]() |
N.A. | LDD0219 | [2] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Caveolin-1 (CAV1) | Caveolin family | Q03135 | |||
Nuclear pore glycoprotein p62 (NUP62) | Nucleoporin NSP1/NUP62 family | P37198 |
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
G-protein coupled receptor-associated sorting protein 2 (GPRASP2) | GPRASP family | Q96D09 |
Other
References