Details of the Target
General Information of Target
| Target ID | LDTP09964 | |||||
|---|---|---|---|---|---|---|
| Target Name | Immunoglobulin superfamily member 2 (CD101) | |||||
| Gene Name | CD101 | |||||
| Gene ID | 9398 | |||||
| Synonyms |
EWI101; IGSF2; V7; Immunoglobulin superfamily member 2; IgSF2; Cell surface glycoprotein V7; Glu-Trp-Ile EWI motif-containing protein 101; EWI-101; CD antigen CD101 |
|||||
| 3D Structure | ||||||
| Sequence |
MELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAEL
TLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVV VGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQV HFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPP LPPPPPLPECLTISPPVPSGPPSKSLLETQYQNVRGRPIFWMEKDI |
|||||
| Target Bioclass |
Immunoglobulin
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function |
Plays a role as inhibitor of T-cells proliferation induced by CD3. Inhibits expression of IL2RA on activated T-cells and secretion of IL2. Inhibits tyrosine kinases that are required for IL2 production and cellular proliferation. Inhibits phospholipase C-gamma-1/PLCG1 phosphorylation and subsequent CD3-induced changes in intracellular free calcium. Prevents nuclear translocation of nuclear factor of activated T-cell to the nucleus. Plays a role in the inhibition of T-cell proliferation via IL10 secretion by cutaneous dendritic cells. May be a marker of CD4(+) CD56(+) leukemic tumor cells.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
N1 Probe Info |
 |
N.A. | LDD0245 | [1] | |