Details of the Target
General Information of Target
| Target ID | LDTP09937 | |||||
|---|---|---|---|---|---|---|
| Target Name | Exostosin-like 1 (EXTL1) | |||||
| Gene Name | EXTL1 | |||||
| Gene ID | 2134 | |||||
| Synonyms |
EXTL; Exostosin-like 1; EC 2.4.1.224; Exostosin-L; Glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase; Multiple exostosis-like protein |
|||||
| 3D Structure | ||||||
| Sequence |
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Glycosyltransferase 47 family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Glycosyltransferase required for the biosynthesis of heparan-sulfate (HS). Transfers N-acetyl-alpha-D-glucosamine to the nascent HS chain (GlcNAcT-II activity). Appears to lack GlcNAcT I and GlcAT-II activities.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C169(3.02) | LDD3484 | [1] | |
Competitor(s) Related to This Target

