Details of the Target
General Information of Target
| Target ID | LDTP09934 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ras-related protein Rab-8B (RAB8B) | |||||
| Gene Name | RAB8B | |||||
| Gene ID | 51762 | |||||
| Synonyms |
Ras-related protein Rab-8B |
|||||
| 3D Structure | ||||||
| Sequence |
MSGRGAGGFPLPPLSPGGGAVAAALGAPPPPAGPGMLPGPALRGPGPAGGVGGPGAAAFR
PMGPAGPAAQYQRPGMSPGNRMPMAGLQVGPPAGSPFGAAAPLRPGMPPTMMDPFRKRLL VPQAQPPMPAQRRGLKRRKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEI QEAIKKPLTQKRKLRIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELRVEGKLLD DPSKQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTL LLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFR QIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQM SNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLK IITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Small GTPase superfamily, Rab family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab may be involved in polarized vesicular trafficking and neurotransmitter release. May participate in cell junction dynamics in Sertoli cells. May participate in the export of a subset of neosynthesized proteins through a Rab8-Rab10-Rab11-dependent endososomal export route.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
 |
11.28 | LDD0402 | [1] | |
|
TH211 Probe Info |
 |
Y5(20.00) | LDD0260 | [2] | |
|
STPyne Probe Info |
 |
K176(8.13) | LDD0277 | [3] | |
|
AZ-9 Probe Info |
 |
E51(1.09) | LDD2208 | [4] | |
|
IPM Probe Info |
 |
N.A. | LDD0241 | [5] | |
|
DBIA Probe Info |
 |
C23(1.55) | LDD3332 | [6] | |
|
BTD Probe Info |
 |
C123(0.80) | LDD2091 | [7] | |
|
Acrolein Probe Info |
 |
N.A. | LDD0227 | [8] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
 |
N.A. | LDD0038 | [9] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD0036 | [9] | |
|
Lodoacetamide azide Probe Info |
 |
N.A. | LDD0037 | [9] | |
|
TFBX Probe Info |
 |
N.A. | LDD0148 | [10] | |
|
1c-yne Probe Info |
 |
N.A. | LDD0228 | [11] | |
|
NAIA_5 Probe Info |
 |
N.A. | LDD2223 | [12] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STS-1 Probe Info |
 |
N.A. | LDD0137 | [13] | |
|
STS-2 Probe Info |
 |
N.A. | LDD0138 | [13] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0156 | Aniline | NCI-H1299 | 11.96 | LDD0403 | [1] |
| LDCM0498 | BS-3668 | MDA-MB-231 | C123(0.80) | LDD2091 | [7] |
| LDCM0022 | KB02 | A498 | C23(1.07) | LDD2259 | [6] |
| LDCM0023 | KB03 | A498 | C23(1.63) | LDD2676 | [6] |
| LDCM0024 | KB05 | MKN45 | C23(1.55) | LDD3332 | [6] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0227 | [8] |
| LDCM0556 | Nucleophilic fragment 8a | MDA-MB-231 | C123(0.33) | LDD2150 | [7] |
The Interaction Atlas With This Target
References