Details of the Target
General Information of Target
| Target ID | LDTP09911 | |||||
|---|---|---|---|---|---|---|
| Target Name | Kallikrein-6 (KLK6) | |||||
| Gene Name | KLK6 | |||||
| Gene ID | 5653 | |||||
| Synonyms |
PRSS18; PRSS9; Kallikrein-6; EC 3.4.21.-; Neurosin; Protease M; SP59; Serine protease 18; Serine protease 9; Zyme |
|||||
| 3D Structure | ||||||
| Sequence |
MGGPRALLAALWALEAAGTAALRIGAFNIQSFGDSKVSDPACGSIIAKILAGYDLALVQE
VRDPDLSAVSALMEQINSVSEHEYSFVSSQPLGRDQYKEMYLFVYRKDAVSVVDTYLYPD PEDVFSREPFVVKFSAPGTGERAPPLPSRRALTPPPLPAAAQNLVLIPLHAAPHQAVAEI DALYDVYLDVIDKWGTDDMLFLGDFNADCSYVRAQDWAAIRLRSSEVFKWLIPDSADTTV GNSDCAYDRIVACGARLRRSLKPQSATVHDFQEEFGLDQTQALAISDHFPVEVTLKFHR |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Peptidase S1 family, Kallikrein subfamily
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Serine protease which exhibits a preference for Arg over Lys in the substrate P1 position and for Ser or Pro in the P2 position. Shows activity against amyloid precursor protein, myelin basic protein, gelatin, casein and extracellular matrix proteins such as fibronectin, laminin, vitronectin and collagen. Degrades alpha-synuclein and prevents its polymerization, indicating that it may be involved in the pathogenesis of Parkinson disease and other synucleinopathies. May be involved in regulation of axon outgrowth following spinal cord injury. Tumor cells treated with a neutralizing KLK6 antibody migrate less than control cells, suggesting a role in invasion and metastasis.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C218(1.51) | LDD3360 | [1] | |
Competitor(s) Related to This Target

