Details of the Target
General Information of Target
| Target ID | LDTP09897 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ectodysplasin-A (EDA) | |||||
| Gene Name | EDA | |||||
| Gene ID | 1896 | |||||
| Synonyms |
ED1; EDA2; Ectodysplasin-A; Ectodermal dysplasia protein; EDA protein) [Cleaved into: Ectodysplasin-A, membrane form; Ectodysplasin-A, secreted form] |
|||||
| 3D Structure | ||||||
| Sequence |
MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVALGSSGEVDRLVAQIGETLQLDAAQHSP
ASPCGPPGAPLRAPGPLAAAVPADKARSPAVPLLLPPALAETVGPAPPGVLRCALGDRGR VRGRAAPYCVAELATGPSALSPLPPQADLDGPPGAGKQGIPQPLSGPCRRGWLRGAAASR RLQQRRGSQPETRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLRAKLPQRPLLGPL SAPVHEPPSPRSPRAACSDPGASGRAQLRTGDGVLVPGS |
|||||
| Target Bioclass |
Cytokine and receptor
|
|||||
| Family |
Tumor necrosis factor family
|
|||||
| Subcellular location |
Secreted; Cell membrane
|
|||||
| Function |
Cytokine which is involved in epithelial-mesenchymal signaling during morphogenesis of ectodermal organs. Functions as a ligand activating the DEATH-domain containing receptors EDAR and EDA2R. May also play a role in cell adhesion.; [Isoform 1]: Binds only to the receptor EDAR, while isoform 3 binds exclusively to the receptor EDA2R.; [Isoform 3]: Binds only to the receptor EDA2R.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
GPCR
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Lysophosphatidic acid receptor 3 (LPAR3) | G-protein coupled receptor 1 family | Q9UBY5 | |||
Other

