Details of the Target

General Information of Target

Target ID LDTP09833
Target Name Protein FAN (NSMAF)
Gene Name NSMAF
Gene ID 8439
Synonyms
FAN; Protein FAN; Factor associated with neutral sphingomyelinase activation; Factor associated with N-SMase activation
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC
IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND
HSVV
Target Bioclass
Other
Function Couples the p55 TNF-receptor (TNF-R55 / TNFR1) to neutral sphingomyelinase (N-SMASE). Specifically binds to the N-smase activation domain of TNF-R55. May regulate ceramide production by N-SMASE.
Uniprot ID
Q92636
Ensemble ID
ENST00000038176.8
HGNC ID
HGNC:8017

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CAL51 Deletion: p.I85Ter .
FTC133 SNV: p.V143L .
HEC1 SNV: p.A730T .
HEC1B SNV: p.A730T .
KYM1 SNV: p.R666T .
LNCaP clone FGC SNV: p.R575M .
MCC13 SNV: p.P447S .
MINO SNV: p.S669T .
NCIH1793 SNV: p.H629R .
NCIH23 Deletion: p.L680FfsTer9
SNV: p.L679Ter		 .
NCIN87 SNV: p.G89Ter .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C466(3.61)  LDD3331  [1]
5E-2FA
 Probe Info  		N.A.  LDD2235  [2]
4-Iodoacetamidophenylacetylene
 Probe Info  		C327(0.00); C412(0.00)  LDD0038  [3]
IA-alkyne
 Probe Info  		C327(0.00); C721(0.00); C435(0.00)  LDD0036  [3]
Lodoacetamide azide
 Probe Info  		C412(0.00); C327(0.00); C435(0.00)  LDD0037  [3]
TFBX
 Probe Info  		N.A.  LDD0027  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0281  AC21 HEK-293T C82(1.14)  LDD1520  [5]
 LDCM0289  AC29 HEK-293T C82(1.02)  LDD1528  [5]
 LDCM0298  AC37 HEK-293T C82(0.96)  LDD1537  [5]
 LDCM0307  AC45 HEK-293T C82(1.10)  LDD1546  [5]
 LDCM0312  AC5 HEK-293T C82(1.12)  LDD1551  [5]
 LDCM0316  AC53 HEK-293T C82(1.12)  LDD1555  [5]
 LDCM0325  AC61 HEK-293T C82(1.31)  LDD1564  [5]
 LDCM0248  AKOS034007472 HEK-293T C82(1.07)  LDD1511  [5]
 LDCM0409  CL21 HEK-293T C82(0.66)  LDD1613  [5]
 LDCM0422  CL33 HEK-293T C82(0.80)  LDD1626  [5]
 LDCM0435  CL45 HEK-293T C82(0.74)  LDD1639  [5]
 LDCM0448  CL57 HEK-293T C82(0.72)  LDD1651  [5]
 LDCM0461  CL69 HEK-293T C82(0.61)  LDD1664  [5]
 LDCM0475  CL81 HEK-293T C82(0.69)  LDD1678  [5]
 LDCM0484  CL9 HEK-293T C82(0.64)  LDD1687  [5]
 LDCM0488  CL93 HEK-293T C82(0.86)  LDD1691  [5]
 LDCM0022  KB02 EoL-1 C752(2.25)  LDD2324  [1]
 LDCM0023  KB03 Jurkat C59(4.41)  LDD0315  [6]
 LDCM0024  KB05 MKN-1 C466(3.61)  LDD3331  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Actin, cytoplasmic 1 (ACTB) Actin family P60709
mRNA-decapping enzyme 1A (DCP1A) DCP1 family Q9NPI6
mRNA-decapping enzyme 1B (DCP1B) DCP1 family Q8IZD4
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Gamma-aminobutyric acid receptor-associated protein (GABARAP) ATG8 family O95166
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAPL1) ATG8 family Q9H0R8
Vasodilator-stimulated phosphoprotein (VASP) Ena/VASP family P50552

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
3 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
4 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
5 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
6 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060