Details of the Target
General Information of Target
Target ID | LDTP09776 | |||||
---|---|---|---|---|---|---|
Target Name | Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1B) | |||||
Gene Name | CPT1B | |||||
Gene ID | 1375 | |||||
Synonyms |
KIAA1670; Carnitine O-palmitoyltransferase 1, muscle isoform; CPT1-M; EC 2.3.1.21; Carnitine O-palmitoyltransferase I, muscle isoform; CPT I; CPTI-M; Carnitine palmitoyltransferase 1B; Carnitine palmitoyltransferase I-like protein
|
|||||
3D Structure | ||||||
Sequence |
MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLG
ERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKK LEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKK DKGGKAKKTAAAGGKKVKKAAKPSVPKVPKGRK |
|||||
Target Type |
Successful
|
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Carnitine/choline acetyltransferase family
|
|||||
Subcellular location |
Mitochondrion outer membrane
|
|||||
Function |
Catalyzes the transfer of the acyl group of long-chain fatty acid-CoA conjugates onto carnitine, an essential step for the mitochondrial uptake of long-chain fatty acids and their subsequent beta-oxidation in the mitochondrion.
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Target Site Mutations in Different Cell Lines
Cell line | Mutation details | Probe for labeling this protein in this cell | |||
---|---|---|---|---|---|
HCC1143 | SNV: p.N266I | . | |||
HCT15 | SNV: p.D631Y | DBIA Probe Info | |||
KO52 | SNV: p.L43V | . | |||
MDAMB231 | SNV: p.F712S | . | |||
MOLT4 | SNV: p.L51I; p.H142Y | . | |||
NALM6 | SNV: p.Y201N | DBIA Probe Info | |||
OVK18 | SNV: p.A474V | DBIA Probe Info | |||
WM115 | SNV: p.E410K | . | |||
WM2664 | SNV: p.E410K | . |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C586(1.71) | LDD3310 | [1] |
Competitor(s) Related to This Target