Details of the Target
General Information of Target
| Target ID | LDTP09776 | |||||
|---|---|---|---|---|---|---|
| Target Name | Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1B) | |||||
| Gene Name | CPT1B | |||||
| Gene ID | 1375 | |||||
| Synonyms |
KIAA1670; Carnitine O-palmitoyltransferase 1, muscle isoform; CPT1-M; EC 2.3.1.21; Carnitine O-palmitoyltransferase I, muscle isoform; CPT I; CPTI-M; Carnitine palmitoyltransferase 1B; Carnitine palmitoyltransferase I-like protein
|
|||||
| 3D Structure | ||||||
| Sequence |
MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLG
ERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKK LEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKK DKGGKAKKTAAAGGKKVKKAAKPSVPKVPKGRK |
|||||
| Target Type |
Successful
|
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Carnitine/choline acetyltransferase family
|
|||||
| Subcellular location |
Mitochondrion outer membrane
|
|||||
| Function |
Catalyzes the transfer of the acyl group of long-chain fatty acid-CoA conjugates onto carnitine, an essential step for the mitochondrial uptake of long-chain fatty acids and their subsequent beta-oxidation in the mitochondrion.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| HCC1143 | SNV: p.N266I | . | |||
| HCT15 | SNV: p.D631Y | DBIA Probe Info | |||
| KO52 | SNV: p.L43V | . | |||
| MDAMB231 | SNV: p.F712S | . | |||
| MOLT4 | SNV: p.L51I; p.H142Y | . | |||
| NALM6 | SNV: p.Y201N | DBIA Probe Info | |||
| OVK18 | SNV: p.A474V | DBIA Probe Info | |||
| WM115 | SNV: p.E410K | . | |||
| WM2664 | SNV: p.E410K | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C586(1.71) | LDD3310 | [1] | |
Competitor(s) Related to This Target

