Details of the Target
General Information of Target
| Target ID | LDTP09738 | |||||
|---|---|---|---|---|---|---|
| Target Name | Jun dimerization protein 2 (JDP2) | |||||
| Gene Name | JDP2 | |||||
| Gene ID | 122953 | |||||
| Synonyms |
Jun dimerization protein 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKR
PQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEE LKQERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKK |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
BZIP family, ATF subfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Involved in a variety of transcriptional responses associated with AP-1 such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris. Can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN. May control transcription via direct regulation of the modification of histones and the assembly of chromatin.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
CY-1 Probe Info |
![]() |
N.A. | LDD0246 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Interferon regulatory factor 2-binding protein 1 (IRF2BP1) | IRF2BP family | Q8IU81 | |||
Transcription factor

