Details of the Target
General Information of Target
| Target ID | LDTP09735 | |||||
|---|---|---|---|---|---|---|
| Target Name | Inhibitor of growth protein 5 (ING5) | |||||
| Gene Name | ING5 | |||||
| Gene ID | 84289 | |||||
| Synonyms |
Inhibitor of growth protein 5; p28ING5 |
|||||
| 3D Structure | ||||||
| Sequence |
MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQ
RVERLQKIQNAYSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKMEGSDF ESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKKHKGGSEFTDTILSVHPSDVLDMP VDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
ING family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Component of the HBO1 complex, which specifically mediates acetylation of histone H3 at 'Lys-14' (H3K14ac) and, to a lower extent, acetylation of histone H4. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. Through chromatin acetylation it may regulate DNA replication and may function as a transcriptional coactivator. Inhibits cell growth, induces a delay in S-phase progression and enhances Fas-induced apoptosis in an INCA1-dependent manner.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [1] | |
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [2] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [3] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| mRNA export factor GLE1 (GLE1) | GLE1 family | Q53GS7 | |||
| Huntingtin (HTT) | Huntingtin family | P42858 | |||
| Wolframin (WFS1) | . | O76024 | |||
Transcription factor
Other
References



