Details of the Target
General Information of Target
| Target ID | LDTP09726 | |||||
|---|---|---|---|---|---|---|
| Target Name | Nanos homolog 1 (NANOS1) | |||||
| Gene Name | NANOS1 | |||||
| Gene ID | 340719 | |||||
| Synonyms |
NOS1; Nanos homolog 1; NOS-1; EC_Rep1a |
|||||
| 3D Structure | ||||||
| Sequence |
MEAFPWAPRSPRRGRAPPPMALVPSARYVSAPGPAHPQPFSSWNDYLGLATLITKAVDGE
PRFGCARGGNGGGGSPPSSSSSSCCSPHTGAGPGALGPALGPPDYDEDDDDDSDEPGSRG RYLGSALELRALELCAGPAEAGLLEERFAELSPFAGRAAAVLLGCAPAAAAAATTTSEAT PREERAPAWAAEPRLHAASGAAAARLLKPELQVCVFCRNNKEAMALYTTHILKGPDGRVL CPVLRRYTCPLCGASGDNAHTIKYCPLSKVPPPPARPPPRSARDGPPGKKLR |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Nanos family
|
|||||
| Subcellular location |
Cytoplasm, perinuclear region
|
|||||
| Function |
May act as a translational repressor which regulates translation of specific mRNAs by forming a complex with PUM2 that associates with the 3'-UTR of mRNA targets. Capable of interfering with the proadhesive and anti-invasive functions of E-cadherin. Up-regulates the production of MMP14 to promote tumor cell invasion.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C241(2.09) | LDD3493 | [1] | |
Competitor(s) Related to This Target

