Details of the Target
General Information of Target
| Target ID | LDTP09698 | |||||
|---|---|---|---|---|---|---|
| Target Name | S-adenosylmethionine-dependent nucleotide dehydratase RSAD2 (RSAD2) | |||||
| Gene Name | RSAD2 | |||||
| Gene ID | 91543 | |||||
| Synonyms |
CIG5; S-adenosylmethionine-dependent nucleotide dehydratase RSAD2; SAND; EC 4.2.-.-; Cytomegalovirus-induced gene 5 protein; Radical S-adenosyl methionine domain-containing protein 2; Virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible; Viperin
|
|||||
| 3D Structure | ||||||
| Sequence |
MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETK
EEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKI NFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISC DSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKAL NPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDS YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLD W |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Radical SAM superfamily, RSAD2 family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Interferon-inducible antiviral protein which plays a major role in the cell antiviral state induced by type I and type II interferon. Catalyzes the conversion of cytidine triphosphate (CTP) to 3'-deoxy-3',4'-didehydro-CTP (ddhCTP) via a SAM-dependent radical mechanism. In turn, ddhCTP acts as a chain terminator for the RNA-dependent RNA polymerases from multiple viruses and directly inhibits viral replication. Therefore, inhibits a wide range of DNA and RNA viruses, including human cytomegalovirus (HCMV), hepatitis C virus (HCV), west Nile virus (WNV), dengue virus, sindbis virus, influenza A virus, sendai virus, vesicular stomatitis virus (VSV), zika virus, and human immunodeficiency virus (HIV-1). Promotes also TLR7 and TLR9-dependent production of IFN-beta production in plasmacytoid dendritic cells (pDCs) by facilitating 'Lys-63'-linked ubiquitination of IRAK1 by TRAF6. Plays a role in CD4+ T-cells activation and differentiation. Facilitates T-cell receptor (TCR)-mediated GATA3 activation and optimal T-helper 2 (Th2) cytokine production by modulating NFKB1 and JUNB activities. Can inhibit secretion of soluble proteins.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C288(1.19) | LDD3412 | [1] | |
|
YN-1 Probe Info |
 |
D273(0.00); E274(0.00) | LDD0447 | [2] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Vesicle-associated membrane protein-associated protein A (VAPA) | VAMP-associated protein (VAP) (TC 9.B.17) family | Q9P0L0 | |||
Other
References