Details of the Target
General Information of Target
| Target ID | LDTP09670 | |||||
|---|---|---|---|---|---|---|
| Target Name | Selenoprotein M (SELENOM) | |||||
| Gene Name | SELENOM | |||||
| Gene ID | 140606 | |||||
| Synonyms |
SELM; Selenoprotein M; SelM |
|||||
| 3D Structure | ||||||
| Sequence |
MSLLLPPLALLLLLAALVAPATAATAYRPDWNRLSGLTRARVETCGGUQLNRLKEVKAFV
TQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAP DAQVPPEYVWAPAKPPEETSDHADL |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Selenoprotein M/F family
|
|||||
| Subcellular location |
Cytoplasm, perinuclear region
|
|||||
| Function | May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Acrolein Probe Info |
![]() |
N.A. | LDD0221 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Signal peptidase complex catalytic subunit SEC11C (SEC11C) | Peptidase S26B family | Q9BY50 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| MyoD family inhibitor (MDFI) | MDFI family | Q99750 | |||
| Magnesium transporter NIPA1 (NIPA1) | NIPA family | Q7RTP0 | |||
Other

