Details of the Target

General Information of Target

Target ID LDTP09668
Target Name Ras association domain-containing protein 5 (RASSF5)
Gene Name RASSF5
Gene ID 83593
Synonyms
NORE1; RAPL; Ras association domain-containing protein 5; New ras effector 1; Regulator for cell adhesion and polarization enriched in lymphoid tissues; RAPL
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPELPPPPPDRSSRLCVPAPLSTAPGAREGR
SARRAARGNLEPPPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERG
EGHCFAELVLPGGPGWCDLCGREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDR
PSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFI
KVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSE
VIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLK
ENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG
Target Bioclass
Other
Subcellular location
Cytoplasm
Function
Potential tumor suppressor. Seems to be involved in lymphocyte adhesion by linking RAP1A activation upon T-cell receptor or chemokine stimulation to integrin activation. Isoform 2 stimulates lymphocyte polarization and the patch-like distribution of ITGAL/LFA-1, resulting in an enhanced adhesion to ICAM1. Together with RAP1A may participate in regulation of microtubule growth. The association of isoform 2 with activated RAP1A is required for directional movement of endothelial cells during wound healing. May be involved in regulation of Ras apoptotic function. The RASSF5-STK4/MST1 complex may mediate HRAS and KRAS induced apoptosis.
Uniprot ID
Q8WWW0
Ensemble ID
ENST00000577571.5
HGNC ID
HGNC:17609

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
AN3CA SNV: p.Y399H .
CCK81 SNV: p.F280V DBIA    Probe Info 
COLO792 SNV: p.E232K .
JURKAT SNV: p.Q26E .
LN229 Deletion: p.Q147_R150del .
NCIH1155 SNV: p.S29R
Substitution: p.L33H		 .
PF382 SNV: p.R146Q .
RL952 SNV: p.G9W .
TOV21G SNV: p.S294T .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K214(1.06)  LDD0277  [1]
IA-alkyne
 Probe Info  		C225(1.76)  LDD0304  [2]
DBIA
 Probe Info  		C225(4.06)  LDD0209  [3]
IPM
 Probe Info  		N.A.  LDD0147  [4]
TFBX
 Probe Info  		N.A.  LDD0148  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 A-375 C45(1.85)  LDD2255  [5]
 LDCM0023  KB03 Jurkat C225(4.06)  LDD0209  [3]
 LDCM0024  KB05 SKMEL24 C45(2.80)  LDD3323  [5]
 LDCM0131  RA190 MM1.R C225(1.76)  LDD0304  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
NADH dehydrogenase flavoprotein 2, mitochondrial (NDUFV2) Complex I 24 kDa subunit family P19404
Serine/threonine-protein kinase 3 (STK3) STE Ser/Thr protein kinase family Q13188
Serine/threonine-protein kinase 4 (STK4) STE Ser/Thr protein kinase family Q13043
GTPase HRas (HRAS) Ras family P01112
Ras-related protein Rap-1A (RAP1A) Ras family P62834
Ras-related protein Rap-1b (RAP1B) Ras family P61224
Ras-related protein Rap-2b (RAP2B) Ras family P61225
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
E3 ubiquitin-protein ligase MYLIP (MYLIP) . Q8WY64
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Gamma-aminobutyric acid receptor-associated protein (GABARAP) ATG8 family O95166
Huntingtin (HTT) Huntingtin family P42858
Junctophilin-3 (JPH3) Junctophilin family Q8WXH2
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Mothers against decapentaplegic homolog 4 (SMAD4) Dwarfin/SMAD family Q13485
Proto-oncogene c-Rel (REL) . Q04864
Other
Click To Hide/Show 13 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAPL1) ATG8 family Q9H0R8
Gamma-aminobutyric acid receptor-associated protein-like 2 (GABARAPL2) ATG8 family P60520
Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) ATG8 family Q9GZQ8
Microtubule-associated proteins 1A/1B light chain 3C (MAP1LC3C) ATG8 family Q9BXW4
Guanine nucleotide exchange factor MSS4 (RABIF) DSS4/MSS4 family P47224
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Keratin-associated protein 4-2 (KRTAP4-2) KRTAP type 4 family Q9BYR5
Vacuolar protein sorting-associated protein 28 homolog (VPS28) VPS28 family Q9UK41
F-box/WD repeat-containing protein 1A (BTRC) . Q9Y297
Methyl-CpG-binding protein 2 (MECP2) . P51608
Ras association domain-containing protein 2 (RASSF2) . P50749
TNF receptor-associated factor 1 (TRAF1) . Q13077

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.
3 Covalent Inhibition by a Natural Product-Inspired Latent Electrophile. J Am Chem Soc. 2023 May 24;145(20):11097-11109. doi: 10.1021/jacs.3c00598. Epub 2023 May 15.
4 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
5 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840