Details of the Target

General Information of Target

Target ID LDTP09659
Target Name GTPase IMAP family member 1 (GIMAP1)
Gene Name GIMAP1
Gene ID 170575
Synonyms
IMAP1; GTPase IMAP family member 1; Immunity-associated protein 1; hIMAP1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQRRFFSRLGAT
SVTRACTTGSRRWDKCHVEVVDTPDIFSSQVSKTDPGCEERGHCYLLSAPGPHALLLVTQ
LGRFTAQDQQAVRQVRDMFGEDVLKWMVIVFTRKEDLAGGSLHDYVSNTENRALRELVAE
CGGRVCAFDNRATGREQEAQVEQLLGMVEGLVLEHKGAHYSNEVYELAQVLRWAGPEERL
RRVAERVAARVQRRPWGAWLSARLWKWLKSPRSWRLGLALLLGGALLFWVLLHRRWSEAV
AEVGPD
Target Bioclass
Enzyme
Family
TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, AIG1/Toc34/Toc159-like paraseptin GTPase family, IAN subfamily
Subcellular location
Endoplasmic reticulum membrane
Function May regulate lymphocyte survival. Required for normal levels of mature T-lymphocytes and mature B-cells.
Uniprot ID
Q8WWP7
Ensemble ID
ENST00000307194.6
HGNC ID
HGNC:23237

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C181(6.49); C186(5.87)  LDD0209  [1]
4-Iodoacetamidophenylacetylene
 Probe Info  		C181(0.00); C98(0.00); C186(0.00); C76(0.00)  LDD0038  [2]
IA-alkyne
 Probe Info  		C76(0.00); C181(0.00); C98(0.00); C66(0.00)  LDD0036  [2]
Lodoacetamide azide
 Probe Info  		C76(0.00); C181(0.00); C104(0.00); C186(0.00)  LDD0037  [2]
Compound 10
 Probe Info  		N.A.  LDD2216  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 DEL C181(2.58)  LDD2315  [4]
 LDCM0023  KB03 Jurkat C181(6.49); C186(5.87)  LDD0209  [1]
 LDCM0024  KB05 PF-382 C66(1.90); C181(1.85)  LDD3397  [4]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Palmitoyltransferase ZDHHC15 (ZDHHC15) DHHC palmitoyltransferase family Q96MV8
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
Very long chain fatty acid elongase 4 (ELOVL4) ELO family Q9GZR5
Glutathione S-transferase 3, mitochondrial (MGST3) MAPEG family O14880
Prostaglandin E synthase (PTGES) MAPEG family O14684
Peroxynitrite isomerase THAP4 (THAP4) Nitrobindin family Q8WY91
Estradiol 17-beta-dehydrogenase 11 (HSD17B11) Short-chain dehydrogenases/reductases (SDR) family Q8NBQ5
ADP-ribosylation factor-like protein 13B (ARL13B) Arf family Q3SXY8
GTP-binding protein SAR1a (SAR1A) SAR1 family Q9NR31
Thioredoxin-related transmembrane protein 1 (TMX1) . Q9H3N1
Transporter and channel
Click To Hide/Show 16 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Stomatin (STOM) Band 7/mec-2 family P27105
Sodium-dependent organic anion transporter (SLC10A6) Bile acid:sodium symporter (BASS) family Q3KNW5
Gap junction alpha-8 protein (GJA8) Connexin family P48165
Novel acetylcholine receptor chaperone (TMEM35A) DoxX family Q53FP2
Endophilin-B1 (SH3GLB1) Endophilin family Q9Y371
Syncytin-2 (ERVFRD-1) Gamma type-C retroviral envelope protein family P60508
Transmembrane 4 L6 family member 19 (TM4SF19) L6 tetraspanin family Q96DZ7
Hippocampus abundant transcript-like protein 1 (MFSD14B) Major facilitator superfamily Q5SR56
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Sodium channel regulatory subunit beta-3 (SCN3B) Sodium channel auxiliary subunit SCN3B family Q9NY72
Syntaxin-1A (STX1A) Syntaxin family Q16623
Transmembrane protein 14B (TMEM14B) TMEM14 family Q9NUH8
Protrudin (ZFYVE27) . Q5T4F4
Thioredoxin-related transmembrane protein 2 (TMX2) . Q9Y320
Transmembrane protein 101 (TMEM101) . Q96IK0
Transmembrane protein 79 (TMEM79) . Q9BSE2
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) BZIP family Q96BA8
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
B-cell antigen receptor complex-associated protein alpha chain (CD79A) . P11912
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Interleukin-3 receptor subunit alpha (IL3RA) Type I cytokine receptor family P26951
Other
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Bladder cancer-associated protein (BLCAP) BLCAP family P62952
Complexin-4 (CPLX4) Complexin/synaphin family Q7Z7G2
Receptor expression-enhancing protein 4 (REEP4) DP1 family Q9H6H4
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Membrane protein FAM174A (FAM174A) FAM174 family Q8TBP5
Protein FAM209A (FAM209A) FAM209 family Q5JX71
Protein jagunal homolog 1 (JAGN1) Jagunal family Q8N5M9
Regulator of microtubule dynamics protein 3 (RMDN3) RMDN family Q96TC7
Transmembrane protein 45B (TMEM45B) TMEM45 family Q96B21
Bcl-2-interacting killer (BIK) . Q13323
C-type lectin domain family 10 member A (CLEC10A) . Q8IUN9

References

1 Covalent Inhibition by a Natural Product-Inspired Latent Electrophile. J Am Chem Soc. 2023 May 24;145(20):11097-11109. doi: 10.1021/jacs.3c00598. Epub 2023 May 15.
2 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
3 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279
4 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840