Details of the Target
General Information of Target
Target ID | LDTP09648 | |||||
---|---|---|---|---|---|---|
Target Name | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 (ASZ1) | |||||
Gene Name | ASZ1 | |||||
Gene ID | 136991 | |||||
Synonyms |
ALP1; ANKL1; C7orf7; GASZ; Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1; Ankyrin-like protein 1; Germ cell-specific ankyrin, SAM and basic leucine zipper domain-containing protein
|
|||||
3D Structure | ||||||
Sequence |
MAASALRGLPVAGGGESSESEDDGWEIGYLDRTSQKLKRLLPIEEKKEKFKKAMTIGDVS
LVQELLDSGISVDSNFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACS AHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDE NGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNP LEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLEVFLHGLGLEHMTDLLKERDI TLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEETKLEISGDEFLNFL LKLNKQCGHLITAVQNVITELPVNSQKITLEWASPQNFTSVCEELVNNVEDLSEKVCKLK DLIQKLQNERENDPTHIQLREEVSTWNSRILKRTAITICGFGFLLFICKLTFQRK |
|||||
Target Bioclass |
Other
|
|||||
Subcellular location |
Cytoplasm
|
|||||
Function |
Plays a central role during spermatogenesis by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons. Its association with pi-bodies suggests a participation in the primary piRNAs metabolic process. Required prior to the pachytene stage to facilitate the production of multiple types of piRNAs, including those associated with repeats involved in the regulation of retrotransposons. May act by mediating protein-protein interactions during germ cell maturation.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IA-alkyne Probe Info |
![]() |
C367(0.54) | LDD2182 | [1] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0573 | Fragment11 | Ramos | C367(2.83) | LDD2190 | [1] |
LDCM0576 | Fragment14 | Ramos | C367(1.08) | LDD2193 | [1] |
LDCM0586 | Fragment28 | Ramos | C367(0.99) | LDD2198 | [1] |
LDCM0566 | Fragment4 | Ramos | C367(0.98) | LDD2184 | [1] |
LDCM0569 | Fragment7 | Ramos | C367(0.51) | LDD2186 | [1] |
LDCM0022 | KB02 | Ramos | C367(0.54) | LDD2182 | [1] |
LDCM0023 | KB03 | Ramos | C367(2.75) | LDD2183 | [1] |
LDCM0024 | KB05 | Ramos | C367(3.81) | LDD2185 | [1] |