Details of the Target
General Information of Target
| Target ID | LDTP09611 | |||||
|---|---|---|---|---|---|---|
| Target Name | U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein (SNRNP27) | |||||
| Gene Name | SNRNP27 | |||||
| Gene ID | 11017 | |||||
| Synonyms |
U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein; U4/U6.U5 snRNP 27 kDa protein; U4/U6.U5-27K; Nucleic acid-binding protein RY-1; U4/U6.U5 tri-snRNP-associated 27 kDa protein; 27K; U4/U6.U5 tri-snRNP-associated protein 3
|
|||||
| 3D Structure | ||||||
| Sequence |
MGRSRSRSPRRERRRSRSTSRERERRRRERSRSRERDRRRSRSRSPHRRRSRSPRRHRST
SPSPSRLKERRDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKV DGSVNAYAINVSQKRKYRQYMNRKGGFNRPLDFIA |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
SNUT3 family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May play a role in mRNA splicing. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Probe 1 Probe Info |
![]() |
Y127(22.92); Y140(79.37) | LDD3495 | [1] | |

