Details of the Target
General Information of Target
| Target ID | LDTP09558 | |||||
|---|---|---|---|---|---|---|
| Target Name | Marginal zone B- and B1-cell-specific protein (MZB1) | |||||
| Gene Name | MZB1 | |||||
| Gene ID | 51237 | |||||
| Synonyms |
MEDA7; PACAP; Marginal zone B- and B1-cell-specific protein; Mesenteric estrogen-dependent adipose 7; MEDA-7; Plasma cell-induced resident endoplasmic reticulum protein; Plasma cell-induced resident ER protein; pERp1; Proapoptotic caspase adapter protein
|
|||||
| 3D Structure | ||||||
| Sequence |
MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQM
WQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSE GPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSE KVSATREEL |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
MZB1 family
|
|||||
| Subcellular location |
Cytoplasm; Endoplasmic reticulum lumen
|
|||||
| Function |
Associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. May exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity. Isoform 2 may be involved in regulation of apoptosis. Helps to diversify peripheral B-cell functions by regulating Ca(2+) stores, antibody secretion and integrin activation.; Acts as a hormone-regulated adipokine/pro-inflammatory cytokine that is implicated in causing chronic inflammation, affecting cellular expansion and blunting insulin response in adipocytes. May have a role in the onset of insulin resistance.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C51(1.07) | LDD3431 | [1] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0166 | [3] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [2] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References




