Details of the Target
General Information of Target
| Target ID | LDTP09551 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cytosolic arginine sensor for mTORC1 subunit 1 (CASTOR1) | |||||
| Gene Name | CASTOR1 | |||||
| Gene ID | 652968 | |||||
| Synonyms |
GATSL3; Cytosolic arginine sensor for mTORC1 subunit 1; Cellular arginine sensor for mTORC1 protein 1; GATS-like protein 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGF
KELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQT DFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSP QNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPEPSSITFFAFSLIEGYISIV MDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYIST FNFDHALVPEDGIGSVIEVLQRRQEGLAS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
GATS family
|
|||||
| Subcellular location |
Cytoplasm, cytosol
|
|||||
| Function |
Functions as an intracellular arginine sensor within the amino acid-sensing branch of the TORC1 signaling pathway. As a homodimer or a heterodimer with CASTOR2, binds and inhibits the GATOR subcomplex GATOR2 and thereby mTORC1. Binding of arginine to CASTOR1 allosterically disrupts the interaction of CASTOR1-containing dimers with GATOR2 which can in turn activate mTORC1 and the TORC1 signaling pathway.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Acrolein Probe Info |
![]() |
N.A. | LDD0232 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| 26S proteasome non-ATPase regulatory subunit 5 (PSMD5) | Proteasome subunit S5B/HSM3 family | Q16401 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Zinc finger C2HC domain-containing protein 1A (ZC2HC1A) | ZC2HC1 family | Q96GY0 | |||
| Zinc finger C2HC domain-containing protein 1B (ZC2HC1B) | ZC2HC1 family | Q5TFG8 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Cytosolic arginine sensor for mTORC1 subunit 1 (CASTOR1) | GATS family | Q8WTX7 | |||
| Translation machinery-associated protein 16 (TMA16) | TMA16 family | Q96EY4 | |||

