Details of the Target
General Information of Target
| Target ID | LDTP09520 | |||||
|---|---|---|---|---|---|---|
| Target Name | Dynein light chain roadblock-type 2 (DYNLRB2) | |||||
| Gene Name | DYNLRB2 | |||||
| Gene ID | 83657 | |||||
| Synonyms |
DNCL2B; DNLC2B; ROBLD2; Dynein light chain roadblock-type 2; Dynein light chain 2B, cytoplasmic; Roadblock domain-containing protein 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDI
DPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCE |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
GAMAD family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton
|
|||||
| Function |
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AZ-9 Probe Info |
 |
D59(10.00); D65(10.00) | LDD2208 | [1] | |