Details of the Target
General Information of Target
| Target ID | LDTP09518 | |||||
|---|---|---|---|---|---|---|
| Target Name | Membrane progestin receptor beta (PAQR8) | |||||
| Gene Name | PAQR8 | |||||
| Gene ID | 85315 | |||||
| Synonyms |
C6orf33; LMPB1; MPRB; Membrane progestin receptor beta; mPR beta; Lysosomal membrane protein in brain 1; Membrane progesterone P4 receptor beta; Membrane progesterone receptor beta; Progesterone and adipoQ receptor family member 8; Progestin and adipoQ receptor family member 8; Progestin and adipoQ receptor family member VIII
|
|||||
| 3D Structure | ||||||
| Sequence |
MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGH
EWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSI TYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFL PAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGC QEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAI LLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
ADIPOR family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Plasma membrane progesterone (P4) receptor coupled to G proteins. Seems to act through a G(i) mediated pathway. May be involved in oocyte maturation. Also binds dehydroepiandrosterone (DHEA), pregnanolone, pregnenolone and allopregnanolone.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPIAA_L Probe Info |
![]() |
N.A. | LDD0031 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Peroxisomal bifunctional enzyme (EHHADH) | Enoyl-CoA hydratase/isomerase family; 3-hydroxyacyl-CoA dehydrogenase family | Q08426 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| 55 kDa erythrocyte membrane protein (MPP1) | MAGUK family | Q00013 | |||
| Leptin receptor overlapping transcript-like 1 (LEPROTL1) | OB-RGRP/VPS55 family | O95214 | |||

