Details of the Target
General Information of Target
Target ID | LDTP09516 | |||||
---|---|---|---|---|---|---|
Target Name | Cyclic AMP-responsive element-binding protein 3-like protein 4 (CREB3L4) | |||||
Gene Name | CREB3L4 | |||||
Gene ID | 148327 | |||||
Synonyms |
AIBZIP; CREB4; JAL; Cyclic AMP-responsive element-binding protein 3-like protein 4; cAMP-responsive element-binding protein 3-like protein 4; Androgen-induced basic leucine zipper protein; AIbZIP; Attaching to CRE-like 1; ATCE1; Cyclic AMP-responsive element-binding protein 4; CREB-4; cAMP-responsive element-binding protein 4; Transcript induced in spermiogenesis protein 40; Tisp40; hJAL) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3-like protein 4]
|
|||||
3D Structure | ||||||
Sequence |
MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGL
QESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSPMLYEVVYEAG ALERMQGETGPNVGLISIQLDQWSPAFMVPDSCMVSELPFDAHAHILPRAGTVAPVPCTT LLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE YIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLI LLFSLALIILPSFSPFQSRPEAGSEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPP GAKDANGSTRTLLEKMGGKPRPSGRIRSVLHADEM |
|||||
Target Bioclass |
Transcription factor
|
|||||
Family |
BZIP family, ATF subfamily
|
|||||
Subcellular location |
Nucleus; Endoplasmic reticulum membrane
|
|||||
Function |
Transcriptional activator that may play a role in the unfolded protein response. Binds to the UPR element (UPRE) but not to CRE element. Preferentially binds DNA with to the consensus sequence 5'-T[GT]ACGT[GA][GT]-3' and has transcriptional activation activity from UPRE. Binds to NF-kappa-B site and has transcriptional activation activity from NF-kappa-B-containing regulatory elements.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C252(2.88) | LDD3493 | [1] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [2] |
Competitor(s) Related to This Target
References