Details of the Target

General Information of Target

Target ID LDTP09409
Target Name Mirror-image polydactyly gene 1 protein (MIPOL1)
Gene Name MIPOL1
Gene ID 145282
Synonyms
Mirror-image polydactyly gene 1 protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MENWSKDITHSYLEQETTGINKSTQPDEQLTMNSEKSMHRKSTELVNEITCENTEWPGQR
STNFQIISSYPDDESVYCTTEKYNVMEHRHNDMHYECMTPCQVTSDSDKEKTIAFLLKEL
DILRTSNKKLQQKLAKEDKEQRKLKFKLELQEKETEAKIAEKTAALVEEVYFAQKERDEA
VMSRLQLAIEERDEAIARAKHMEMSLKVLENINPEENDMTLQELLNRINNADTGIAIQKN
GAIIVDRIYKTKECKMRITAEEMSALIEERDAALSKCKRLEQELHHVKEQNQTSANNMRH
LTAENNQERALKAKLLSMQQARETAVQQYKKLEEEIQTLRVYYSLHKSLSQEENLKDQFN
YTLSTYEEALKNRENIVSITQQQNEELATQLQQALTERANMELQLQHAREASQVANEKVQ
KLERLVDVLRKKVGTGTMRTVI
Target Bioclass
Other
Uniprot ID
Q8TD10
Ensemble ID
ENST00000327441.11
HGNC ID
HGNC:21460

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HT115 SNV: p.R60K .
JHH7 SNV: p.S294Ter .
MCC13 Substitution: p.H10L .
MEWO SNV: p.M401I .
MFE319 Deletion: p.E210KfsTer10 .
NCIH358 SNV: p.V85L .
OAW42 SNV: p.A408S .
SISO Deletion: p.E110DfsTer17 .
SW403 SNV: p.I379N .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
YN-1
 Probe Info  		N.A.  LDD0447  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
DNA replication licensing factor MCM7 (MCM7) MCM family P33993
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
Serine/threonine-protein kinase N1 (PKN1) AGC Ser/Thr protein kinase family Q16512
Cyclin-dependent kinase 18 (CDK18) CMGC Ser/Thr protein kinase family Q07002
Proto-oncogene serine/threonine-protein kinase mos (MOS) Ser/Thr protein kinase family P00540
GTP-binding protein GEM (GEM) RGK family P55040
Thioredoxin, mitochondrial (TXN2) Thioredoxin family Q99757
Kinesin-like protein KIF9 (KIF9) Kinesin family Q9HAQ2
Ubiquitin-conjugating enzyme E2 K (UBE2K) Ubiquitin-conjugating enzyme family P61086
E3 ubiquitin-protein ligase MYLIP (MYLIP) . Q8WY64
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ATP synthase subunit O, mitochondrial (ATP5PO) ATPase delta chain family P48047
Hsp90 co-chaperone Cdc37 (CDC37) CDC37 family Q16543
Exocyst complex component 8 (EXOC8) EXO84 family Q8IYI6
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Transcription factor
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
REST corepressor 3 (RCOR3) CoREST family Q9P2K3
Zinc finger protein Aiolos (IKZF3) Ikaros C2H2-type zinc-finger protein family Q9UKT9
Paired box protein Pax-6 (PAX6) Paired homeobox family P26367
Pre-B-cell leukemia transcription factor 4 (PBX4) TALE/PBX homeobox family Q9BYU1
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (SMARCE1) . Q969G3
Zinc finger CCCH-type with G patch domain-containing protein (ZGPAT) . Q8N5A5
Other
Click To Hide/Show 39 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Apoptosis-stimulating of p53 protein 1 (PPP1R13B) ASPP family Q96KQ4
Protein BEX2 (BEX2) BEX family Q9BXY8
Bystin (BYSL) Bystin family Q13895
Cyclin-dependent kinases regulatory subunit 1 (CKS1B) CKS family P61024
EKC/KEOPS complex subunit LAGE3 (LAGE3) CTAG/PCC1 family Q14657
Death domain-associated protein 6 (DAXX) DAXX family Q9UER7
ELL-associated factor 1 (EAF1) EAF family Q96JC9
Eukaryotic translation initiation factor 4E type 2 (EIF4E2) Eukaryotic initiation factor 4E family O60573
Protein FAM161A (FAM161A) FAM161 family Q3B820
Protein FAM161B (FAM161B) FAM161 family Q96MY7
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
HAUS augmin-like complex subunit 1 (HAUS1) HAUS1 family Q96CS2
Microfibrillar-associated protein 1 (MFAP1) MFAP1 family P55081
Large ribosomal subunit protein mL64 (GADD45GIP1) Mitochondrion-specific ribosomal protein mL64 family Q8TAE8
U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31) PRP31 family Q8WWY3
tRNA-splicing endonuclease subunit Sen15 (TSEN15) SEN15 family Q8WW01
Protein SSX3 (SSX3) SSX family Q99909
Stathmin-3 (STMN3) Stathmin family Q9NZ72
Trichoplein keratin filament-binding protein (TCHP) TCHP family Q9BT92
T-complex protein 1 subunit gamma (CCT3) TCP-1 chaperonin family P49368
U3 small nucleolar RNA-associated protein 25 homolog (UTP25) UTP25 family Q68CQ4
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
Ankyrin repeat domain-containing protein 23 (ANKRD23) . Q86SG2
Cation channel sperm-associated targeting subunit tau (C2CD6) . Q53TS8
Coiled-coil domain-containing protein 120 (CCDC120) . Q96HB5
Coiled-coil domain-containing protein 146 (CCDC146) . Q8IYE0
Enkurin domain-containing protein 1 (ENKD1) . Q9H0I2
Harmonin (USH1C) . Q9Y6N9
Keratinocyte differentiation factor 1 (KDF1) . Q8NAX2
Leukocyte receptor cluster member 1 (LENG1) . Q96BZ8
Melanoma-associated antigen 6 (MAGEA6) . P43360
Mirror-image polydactyly gene 1 protein (MIPOL1) . Q8TD10
Multiple myeloma tumor-associated protein 2 (MMTAG2) . Q9BU76
Nebulette (NEBL) . O76041
Protein hinderin (KIAA1328) . Q86T90
Receptor-transporting protein 5 (RTP5) . Q14D33
RNA-binding protein 41 (RBM41) . Q96IZ5
TBC1 domain family member 7 (TBC1D7) . Q9P0N9
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00

References

1 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.