Details of the Target
General Information of Target
| Target ID | LDTP09406 | |||||
|---|---|---|---|---|---|---|
| Target Name | Anterior gradient protein 3 (AGR3) |
|
||||
| Gene Name | AGR3 | |||||
| Gene ID | 155465 | |||||
| Synonyms |
BCMP11; PDIA18; Anterior gradient protein 3; AG-3; AG3; hAG-3; Anterior gradient 3 homolog; Breast cancer membrane protein 11; Protein disulfide isomerase family A, member 18 |
|||||
| 3D Structure | ||||||
| Sequence |
MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKK
PLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIM FVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
AGR family
|
|||||
| Subcellular location |
Endoplasmic reticulum
|
|||||
| Function | Required for calcium-mediated regulation of ciliary beat frequency and mucociliary clearance in the airway. Might be involved in the regulation of intracellular calcium in tracheal epithelial cells. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Probe 1 Probe Info |
 |
Y115(8.09); Y141(8.12) | LDD3495 | [1] | |
|
DBIA Probe Info |
 |
C71(2.68) | LDD2268 | [2] | |
|
NAIA_5 Probe Info |
 |
N.A. | LDD2223 | [3] | |
Competitor(s) Related to This Target
References