Details of the Target

General Information of Target

Target ID LDTP09326
Target Name (Lyso)-N-acylphosphatidylethanolamine lipase (ABHD4)
Gene Name ABHD4
Gene ID 63874
Synonyms
(Lyso)-N-acylphosphatidylethanolamine lipase; EC 3.1.1.-; Alpha/beta hydrolase domain-containing protein 4; Abhydrolase domain-containing protein 4; Alpha/beta-hydrolase 4
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVT
VSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGA
EDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTN
PSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISE
YIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKK
VKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD
Target Bioclass
Enzyme
Family
Peptidase S33 family, ABHD4/ABHD5 subfamily
Function
Lysophospholipase selective for N-acyl phosphatidylethanolamine (NAPE). Contributes to the biosynthesis of N-acyl ethanolamines, including the endocannabinoid anandamide by hydrolyzing the sn-1 and sn-2 acyl chains from N-acyl phosphatidylethanolamine (NAPE) generating glycerophospho-N-acyl ethanolamine (GP-NAE), an intermediate for N-acyl ethanolamine biosynthesis. Hydrolyzes substrates bearing saturated, monounsaturated, polyunsaturated N-acyl chains. Shows no significant activity towards other lysophospholipids, including lysophosphatidylcholine, lysophosphatidylethanolamine and lysophosphatidylserine.
Uniprot ID
Q8TB40
Ensemble ID
ENST00000418446.6
HGNC ID
HGNC:20154

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HEC1 SNV: p.I56T .
MFE319 SNV: p.M88I .
NCIH1299 SNV: p.M1? .
NCIH661 SNV: p.R94L .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C38(0.94)  LDD3353  [1]
IA-alkyne
 Probe Info  		N.A.  LDD0162  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0226  AC11 HEK-293T C38(0.97)  LDD1509  [3]
 LDCM0278  AC19 HEK-293T C38(1.02)  LDD1517  [3]
 LDCM0287  AC27 HEK-293T C38(1.19)  LDD1526  [3]
 LDCM0290  AC3 HEK-293T C38(1.20)  LDD1529  [3]
 LDCM0296  AC35 HEK-293T C38(1.08)  LDD1535  [3]
 LDCM0305  AC43 HEK-293T C38(1.07)  LDD1544  [3]
 LDCM0314  AC51 HEK-293T C38(1.09)  LDD1553  [3]
 LDCM0322  AC59 HEK-293T C38(0.99)  LDD1561  [3]
 LDCM0371  CL102 HEK-293T C38(1.07)  LDD1575  [3]
 LDCM0375  CL106 HEK-293T C38(1.03)  LDD1579  [3]
 LDCM0380  CL110 HEK-293T C38(0.94)  LDD1584  [3]
 LDCM0384  CL114 HEK-293T C38(1.10)  LDD1588  [3]
 LDCM0388  CL118 HEK-293T C38(0.98)  LDD1592  [3]
 LDCM0393  CL122 HEK-293T C38(1.11)  LDD1597  [3]
 LDCM0397  CL126 HEK-293T C38(1.02)  LDD1601  [3]
 LDCM0401  CL14 HEK-293T C38(1.12)  LDD1605  [3]
 LDCM0406  CL19 HEK-293T C38(1.31)  LDD1610  [3]
 LDCM0407  CL2 HEK-293T C38(1.07)  LDD1611  [3]
 LDCM0414  CL26 HEK-293T C38(0.80)  LDD1618  [3]
 LDCM0420  CL31 HEK-293T C38(1.08)  LDD1624  [3]
 LDCM0433  CL43 HEK-293T C38(0.98)  LDD1637  [3]
 LDCM0441  CL50 HEK-293T C38(1.07)  LDD1645  [3]
 LDCM0446  CL55 HEK-293T C38(1.18)  LDD1649  [3]
 LDCM0454  CL62 HEK-293T C38(0.93)  LDD1657  [3]
 LDCM0459  CL67 HEK-293T C38(1.14)  LDD1662  [3]
 LDCM0462  CL7 HEK-293T C38(1.22)  LDD1665  [3]
 LDCM0467  CL74 HEK-293T C38(0.97)  LDD1670  [3]
 LDCM0472  CL79 HEK-293T C38(1.07)  LDD1675  [3]
 LDCM0480  CL86 HEK-293T C38(1.02)  LDD1683  [3]
 LDCM0486  CL91 HEK-293T C38(1.03)  LDD1689  [3]
 LDCM0493  CL98 HEK-293T C38(0.95)  LDD1696  [3]
 LDCM0427  Fragment51 HEK-293T C38(0.89)  LDD1631  [3]
 LDCM0022  KB02 786-O C38(1.39)  LDD2247  [1]
 LDCM0023  KB03 786-O C38(2.21)  LDD2664  [1]
 LDCM0024  KB05 NCI-H2052 C38(0.94)  LDD3353  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Diacylglycerol O-acyltransferase 2-like protein 6 (DGAT2L6) Diacylglycerol acyltransferase family Q6ZPD8
BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 (BNIP2) . Q12982
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Derlin-1 (DERL1) Derlin family Q9BUN8
Insulin-induced gene 2 protein (INSIG2) INSIG family Q9Y5U4
Prenylated Rab acceptor protein 1 (RABAC1) PRA1 family Q9UI14
Other
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Receptor expression-enhancing protein 5 (REEP5) DP1 family Q00765
Small ribosomal subunit protein mS38 (AURKAIP1) Mitochondrion-specific ribosomal protein mS38 family Q9NWT8
Perilipin-3 (PLIN3) Perilipin family O60664
Insulin-like growth factor-binding protein 5 (IGFBP5) . P24593

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
3 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402