Details of the Target
General Information of Target
| Target ID | LDTP09249 | |||||
|---|---|---|---|---|---|---|
| Target Name | E3 ubiquitin-protein ligase ZNRF2 (ZNRF2) | |||||
| Gene Name | ZNRF2 | |||||
| Gene ID | 223082 | |||||
| Synonyms |
RNF202; E3 ubiquitin-protein ligase ZNRF2; EC 2.3.2.27; Protein Ells2; RING finger protein 202; RING-type E3 ubiquitin transferase ZNRF2; Zinc/RING finger protein 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MGAKQSGPAAANGRTRAYSGSDLPSSSSGGANGTAGGGGGARAAAAGRFPAQVPSAHQPS
ASGGAAAAAAAPAAPAAPRSRSLGGAVGSVASGARAAQSPFSIPNSSSGPYGSQDSVHSS PEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCL TKPRITYNEDVLSKDAGECAICLEELQQGDTIARLPCLCIYHKGCIDEWFEVNRSCPEHP SD |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Subcellular location |
Endosome membrane
|
|||||
| Function |
E3 ubiquitin-protein ligase that plays a role in the establishment and maintenance of neuronal transmission and plasticity. Ubiquitinates the Na(+)/K(+) ATPase alpha-1 subunit/ATP1A1 and thereby influences its endocytosis and/or degradation. Acts also as a positive regulator of mTORC1 activation by amino acids, which functions upstream of the V-ATPase and of Rag-GTPases. In turn, phosphorylation by mTOR leads to its inhibition via targeting to the cytosol allowing a self-regulating feedback mechanism.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Probe 1 Probe Info |
![]() |
Y18(14,027.72) | LDD3495 | [1] | |
|
DBIA Probe Info |
![]() |
C236(1.01) | LDD3365 | [2] | |
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [3] | |
|
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [3] | |
Competitor(s) Related to This Target
References




