Details of the Target

General Information of Target

Target ID	LDTP09248
Target Name	Small VCP/p97-interacting protein (SVIP)
Gene Name	SVIP
Gene ID	258010
Synonyms	Small VCP/p97-interacting protein
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQ IATSGPPPEGGLRWTVS
Target Bioclass	Other
Family	SVIP family
Subcellular location	Smooth endoplasmic reticulum membrane
Uniprot ID	Q8NHG7
Ensemble ID	ENST00000354193.5
HGNC ID	HGNC:25238

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 2 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
STPyne Probe Info			K50(10.00)	LDD0277	[1]
AOyne Probe Info			15.00	LDD0443	[2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other

Click To Hide/Show 1 Protein(s) Interacting with This Target

Protein name				Family	Uniprot ID
UBX domain-containing protein 6 (UBXN6)				.	Q9BZV1

References

1	A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10. Mass spectrometry data entry: PXD028270
2	Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.