Details of the Target

General Information of Target

Target ID LDTP09236
Target Name TNFAIP3-interacting protein 2 (TNIP2)
Gene Name TNIP2
Gene ID 79155
Synonyms
ABIN2; FLIP1; TNFAIP3-interacting protein 2; A20-binding inhibitor of NF-kappa-B activation 2; ABIN-2; Fetal liver LKB1-interacting protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSRDPGSGGWEEAPRAAAALCTLYHEAGQRLRRLQDQLAARDALIARLRARLAALEGDAA
PSLVDALLEQVARFREQLRRQEGGAAEAQMRQEIERLTERLEEKEREMQQLLSQPQHERE
KEVVLLRRSMAEGERARAASDVLCRSLANETHQLRRTLTATAHMCQHLAKCLDERQHAQR
NVGERSPDQSEHTDGHTSVQSVIEKLQEENRLLKQKVTHVEDLNAKWQRYNASRDEYVRG
LHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQELAASRTARDAALERVQMLE
QQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAGRIHAGSKTAK
YLAADALELMVPGGWRPGTGSQQPEPPAEGGHPGAAQRGQGDLQCPHCLQCFSDEQGEEL
LRHVAECCQ
Target Bioclass
Other
Subcellular location
Cytoplasm
Function
Inhibits NF-kappa-B activation by blocking the interaction of RIPK1 with its downstream effector NEMO/IKBKG. Forms a ternary complex with NFKB1 and MAP3K8 but appears to function upstream of MAP3K8 in the TLR4 signaling pathway that regulates MAP3K8 activation. Involved in activation of the MEK/ERK signaling pathway during innate immune response; this function seems to be stimulus- and cell type specific. Required for stability of MAP3K8. Involved in regulation of apoptosis in endothelial cells; promotes TEK agonist-stimulated endothelial survival. May act as transcriptional coactivator when translocated to the nucleus. Enhances CHUK-mediated NF-kappa-B activation involving NF-kappa-B p50-p65 and p50-c-Rel complexes.
Uniprot ID
Q8NFZ5
Ensemble ID
ENST00000315423.12
HGNC ID
HGNC:19118

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CAMA1 SNV: p.R323S .
KNS81FD SNV: p.G391E .
LNCaP clone FGC SNV: p.W340Ter .
MELHO Substitution: p.C427A .
MOLT4 SNV: p.R75P; p.Q397K .
SUPT1 SNV: p.R30L .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
BTD
 Probe Info  		C21(0.36)  LDD2144  [1]
IA-alkyne
 Probe Info  		C21(6.21)  LDD1705  [2]
DBIA
 Probe Info  		C21(1.36)  LDD1507  [3]
IPM
 Probe Info  		N.A.  LDD0147  [4]
TFBX
 Probe Info  		C21(0.00); C144(0.00); C171(0.00)  LDD0148  [4]
NAIA_5
 Probe Info  		N.A.  LDD2223  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0214  AC1 HEK-293T C21(1.36)  LDD1507  [3]
 LDCM0276  AC17 HEK-293T C21(1.10)  LDD1515  [3]
 LDCM0285  AC25 HEK-293T C21(1.36)  LDD1524  [3]
 LDCM0294  AC33 HEK-293T C21(1.26)  LDD1533  [3]
 LDCM0303  AC41 HEK-293T C21(1.19)  LDD1542  [3]
 LDCM0311  AC49 HEK-293T C21(1.13)  LDD1550  [3]
 LDCM0320  AC57 HEK-293T C21(1.43)  LDD1559  [3]
 LDCM0356  AKOS034007680 HEK-293T C21(1.32)  LDD1570  [3]
 LDCM0632  CL-Sc Hep-G2 C21(1.48)  LDD2227  [5]
 LDCM0404  CL17 HEK-293T C21(1.94)  LDD1608  [3]
 LDCM0417  CL29 HEK-293T C21(0.99)  LDD1621  [3]
 LDCM0431  CL41 HEK-293T C21(1.01)  LDD1635  [3]
 LDCM0440  CL5 HEK-293T C21(1.12)  LDD1644  [3]
 LDCM0444  CL53 HEK-293T C21(1.32)  LDD1647  [3]
 LDCM0457  CL65 HEK-293T C21(1.19)  LDD1660  [3]
 LDCM0470  CL77 HEK-293T C21(1.42)  LDD1673  [3]
 LDCM0483  CL89 HEK-293T C21(1.11)  LDD1686  [3]
 LDCM0022  KB02 HCC1187 C275(1.80)  LDD2337  [6]
 LDCM0023  KB03 HCC1187 C275(2.87)  LDD2754  [6]
 LDCM0024  KB05 T cell C21(6.21)  LDD1705  [2]
 LDCM0550  Nucleophilic fragment 5a MDA-MB-231 C21(0.36)  LDD2144  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Tumor necrosis factor alpha-induced protein 3 (TNFAIP3) Peptidase C64 family P21580
Serine/threonine-protein kinase STK11 (STK11) CAMK Ser/Thr protein kinase family Q15831
Mitogen-activated protein kinase kinase kinase 8 (MAP3K8) STE Ser/Thr protein kinase family P41279
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nuclear factor NF-kappa-B p105 subunit (NFKB1) . P19838
Proto-oncogene c-Rel (REL) . Q04864
Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
NF-kappa-B essential modulator (IKBKG) . Q9Y6K9

References

1 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
2 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.
3 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
4 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
5 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
6 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840