Details of the Target
General Information of Target
| Target ID | LDTP09169 | |||||
|---|---|---|---|---|---|---|
| Target Name | Activin receptor type-1C (ACVR1C) | |||||
| Gene Name | ACVR1C | |||||
| Gene ID | 130399 | |||||
| Synonyms |
ALK7; Activin receptor type-1C; EC 2.7.11.30; Activin receptor type IC; ACTR-IC; Activin receptor-like kinase 7; ALK-7 |
|||||
| 3D Structure | ||||||
| Sequence |
MTRALCSALRQALLLLAAAAELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVI
KSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITV PVCLLSIAAMLTVWACQGRQCSYRKKKRPNVEEPLSECNLVNAGKTLKDLIYDVTASGSG SGLPLLVQRTIARTIVLQEIVGKGRFGEVWHGRWCGEDVAVKIFSSRDERSWFREAEIYQ TVMLRHENILGFIAADNKDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTVAGMIKLALSIA SGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDSILNTIDIPQN PKVGTKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRCSVGGIVEEYQLPYYD MVPSDPSIEEMRKVVCDQKFRPSIPNQWQSCEALRVMGRIMRECWYANGAARLTALRIKK TISQLCVKEDCKA |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function |
Serine/threonine protein kinase which forms a receptor complex on ligand binding. The receptor complex consisting of 2 type II and 2 type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators, SMAD2 and SMAD3. Receptor for activin AB, activin B and NODAL. Plays a role in cell differentiation, growth arrest and apoptosis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C517(2.94) | LDD3339 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0226 | AC11 | HEK-293T | C215(0.84) | LDD1509 | [2] |
| LDCM0278 | AC19 | HEK-293T | C215(0.98) | LDD1517 | [2] |
| LDCM0287 | AC27 | HEK-293T | C215(0.96) | LDD1526 | [2] |
| LDCM0290 | AC3 | HEK-293T | C215(0.87) | LDD1529 | [2] |
| LDCM0296 | AC35 | HEK-293T | C215(0.98) | LDD1535 | [2] |
| LDCM0305 | AC43 | HEK-293T | C215(0.88) | LDD1544 | [2] |
| LDCM0314 | AC51 | HEK-293T | C215(0.96) | LDD1553 | [2] |
| LDCM0322 | AC59 | HEK-293T | C215(0.96) | LDD1561 | [2] |
| LDCM0406 | CL19 | HEK-293T | C215(1.00) | LDD1610 | [2] |
| LDCM0420 | CL31 | HEK-293T | C215(0.96) | LDD1624 | [2] |
| LDCM0433 | CL43 | HEK-293T | C215(0.91) | LDD1637 | [2] |
| LDCM0446 | CL55 | HEK-293T | C215(0.96) | LDD1649 | [2] |
| LDCM0459 | CL67 | HEK-293T | C215(0.94) | LDD1662 | [2] |
| LDCM0462 | CL7 | HEK-293T | C215(1.06) | LDD1665 | [2] |
| LDCM0472 | CL79 | HEK-293T | C215(0.90) | LDD1675 | [2] |
| LDCM0486 | CL91 | HEK-293T | C215(0.89) | LDD1689 | [2] |
| LDCM0022 | KB02 | CCK-81 | C517(2.32) | LDD2297 | [1] |
| LDCM0023 | KB03 | CCK-81 | C517(3.05) | LDD2714 | [1] |
| LDCM0024 | KB05 | NALM-6 | C517(2.94) | LDD3339 | [1] |
References

