Details of the Target
General Information of Target
| Target ID | LDTP09167 | |||||
|---|---|---|---|---|---|---|
| Target Name | Steroid receptor-associated and regulated protein (SRARP) | |||||
| Gene Name | SRARP | |||||
| Gene ID | 149563 | |||||
| Synonyms |
C1orf64; ERRF; SSPR; Steroid receptor-associated and regulated protein; Estrogen receptor-related factor; ER-related factor; Steroid receptor-regulated protein |
|||||
| 3D Structure | ||||||
| Sequence |
MAPSEDPRDWRANLKGTIRETGLETSSGGKLAGHQKTVPTAHLTFVIDCTHGKQLSLAAT
ASPPQAPSPNRGLVTPPMKTYIVFCGENWPHLTRVTPMGGGCLAQARATLPLCRGSVASA SFPVSPLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKALSSCVCGQAD |
|||||
| Target Bioclass |
Other
|
|||||
| Function | May regulate the transcriptional function of androgen and estrogen receptors. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C102(3.58) | LDD2268 | [1] | |
Competitor(s) Related to This Target

