Details of the Target
General Information of Target
Target ID | LDTP09150 | |||||
---|---|---|---|---|---|---|
Target Name | Blood vessel epicardial substance (BVES) | |||||
Gene Name | BVES | |||||
Gene ID | 11149 | |||||
Synonyms |
POP1; POPDC1; Blood vessel epicardial substance; hBVES; Popeye domain-containing protein 1; Popeye protein 1 |
|||||
3D Structure | ||||||
Sequence |
MNYTESSPLRESTAIGFTPELESIIPVPSNKTTCENWREIHHLVFHVANICFAVGLVIPT
TLHLHMIFLRGMLTLGCTLYIVWATLYRCALDIMIWNSVFLGVNILHLSYLLYKKRPVKI EKELSGMYRRLFEPLRVPPDLFRRLTGQFCMIQTLKKGQTYAAEDKTSVDDRLSILLKGK MKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLE SEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS DSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
Popeye family
|
|||||
Subcellular location |
Lateral cell membrane
|
|||||
Function |
Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. Involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. Plays a role in VAMP3-mediated vesicular transport and recycling of different receptor molecules through its interaction with VAMP3. Plays a role in the regulation of cell shape and movement by modulating the Rho-family GTPase activity through its interaction with ARHGEF25/GEFT. Induces primordial adhesive contact and aggregation of epithelial cells in a Ca(2+)-independent manner. Also involved in striated muscle regeneration and repair and in the regulation of cell spreading. Important for the maintenance of cardiac function. Plays a regulatory function in heart rate dynamics mediated, at least in part, through cAMP-binding and, probably, by increasing cell surface expression of the potassium channel KCNK2 and enhancing current density. Is also a caveolae-associated protein important for the preservation of caveolae structural and functional integrity as well as for heart protection against ischemia injury.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C221(2.13); C745(1.15); C358(1.39) | LDD3310 | [1] | |
NAIA_5 Probe Info |
![]() |
C530(0.00); C777(0.00); C804(0.00); C745(0.00) | LDD2224 | [2] |
Competitor(s) Related to This Target
References