Details of the Target
General Information of Target
Target ID | LDTP09135 | |||||
---|---|---|---|---|---|---|
Target Name | Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 (ST6GALNAC3) | |||||
Gene Name | ST6GALNAC3 | |||||
Gene ID | 256435 | |||||
Synonyms |
SIAT7C; Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3; EC 2.4.3.7; GalNAc alpha-2,6-sialyltransferase III; ST6GalNAc III; ST6GalNAcIII; STY; Sialyltransferase 7C; SIAT7-C |
|||||
3D Structure | ||||||
Sequence |
MACILKRKSVIAVSFIAAFLFLLVVRLVNEVNFPLLLNCFGQPGTKWIPFSYTYRRPLRT
HYGYINVKTQEPLQLDCDLCAIVSNSGQMVGQKVGNEIDRSSCIWRMNNAPTKGYEEDVG RMTMIRVVSHTSVPLLLKNPDYFFKEANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIY PNAQIYVTTEKRMSYCDGVFKKETGKDRVQSGSYLSTGWFTFLLAMDACYGIHVYGMIND TYCKTEGYRKVPYHYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHP NWTLS |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Glycosyltransferase 29 family
|
|||||
Subcellular location |
Golgi apparatus membrane
|
|||||
Function |
Transfers the sialyl group (N-acetyl-alpha-neuraminyl or NeuAc) from CMP-NeuAc to the GalNAc residue on the NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc sequence of glycoproteins and glycolipids forming an alpha-2,6-linkage. Produces branched type disialyl structures by transfer of a sialyl group onto a GalNAc residue inside the backbone core chains. ST6GalNAcIII prefers glycolipids to glycoproteins, predominantly catalyzing the biosynthesis of ganglioside GD1alpha from GM1b. GD1alpha is a critical molecule in the communication and interaction between neuronal cells and their supportive cells, particularly in brain tissues, and functions as an adhesion molecule in the process of metastasis. Sialylation of glycoproteins or glycosphingolipids is very important in tumor development, neuronal development, nerve repair, immunological processes and regulation of hormone sensitivity.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C196(1.57) | LDD3419 | [1] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target