General Information of Target

Target ID LDTP09114
Target Name E3 ubiquitin-protein ligase ZNRF1 (ZNRF1)
Gene Name ZNRF1
Gene ID 84937
Synonyms
NIN283; E3 ubiquitin-protein ligase ZNRF1; EC 2.3.2.27; Nerve injury-induced gene 283 protein; RING-type E3 ubiquitin transferase ZNRF1; Zinc/RING finger protein 1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMD
PSTAGGVPFGLYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGS
RASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKD
AGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHPAD
Target Bioclass
Enzyme
Subcellular location
Endosome
Function
E3 ubiquitin-protein ligase that plays a role in different processes including cell differentiation, receptor recycling or regulation of inflammation. Mediates the ubiquitination of AKT1 and GLUL, thereby playing a role in neuron cells differentiation. Plays a role in the establishment and maintenance of neuronal transmission and plasticity. Regulates Schwann cells differentiation by mediating ubiquitination of GLUL. Promotes neurodegeneration by mediating 'Lys-48'-linked polyubiquitination and subsequent degradation of AKT1 in axons: degradation of AKT1 prevents AKT1-mediated phosphorylation of GSK3B, leading to GSK3B activation and phosphorylation of DPYSL2/CRMP2 followed by destabilization of microtubule assembly in axons. Ubiquitinates the Na(+)/K(+) ATPase alpha-1 subunit/ATP1A1 and thereby influences its endocytosis and/or degradation. Controls ligand-induced EGFR signaling via mediating receptor ubiquitination and recruitment of the ESCRT machinery. Acts as a negative feedback mechanism controlling TLR3 trafficking by mediating TLR3 'Lys-63'-linked polyubiquitination to reduce type I IFN production. Modulates inflammation by promoting caveolin-1/CAV1 ubiquitination and degradation to regulate TLR4-activated immune response.
Uniprot ID
Q8ND25
Ensemble ID
ENST00000320619.10
HGNC ID
HGNC:18452

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
IGROV1 SNV: p.G3D DBIA    Probe Info 
MFE319 SNV: p.R12Q DBIA    Probe Info 
NCIH2286 SNV: p.G108C .
SNU1 Insertion: p.V67GfsTer46 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C272(1.18)  LDD3345  [1]
Acrolein
 Probe Info 
C184(0.00); C187(0.00)  LDD0225  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 A-172 C272(1.11)  LDD2251  [1]
 LDCM0023  KB03 A-172 C272(1.61)  LDD2668  [1]
 LDCM0024  KB05 NCI-H1650 C272(1.18)  LDD3345  [1]
 LDCM0109  NEM HeLa C184(0.00); C187(0.00)  LDD0225  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ubiquitin-conjugating enzyme E2 D1 (UBE2D1) Ubiquitin-conjugating enzyme family P51668
Ubiquitin-conjugating enzyme E2 D2 (UBE2D2) Ubiquitin-conjugating enzyme family P62837
Ubiquitin-conjugating enzyme E2 D3 (UBE2D3) Ubiquitin-conjugating enzyme family P61077
Ubiquitin-conjugating enzyme E2 D4 (UBE2D4) Ubiquitin-conjugating enzyme family Q9Y2X8
Ubiquitin-conjugating enzyme E2 E1 (UBE2E1) Ubiquitin-conjugating enzyme family P51965
Ubiquitin-conjugating enzyme E2 N (UBE2N) Ubiquitin-conjugating enzyme family P61088
Ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1) Ubiquitin-conjugating enzyme family Q13404
Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
UBX domain-containing protein 7 (UBXN7) . O94888

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.