Details of the Target
General Information of Target
| Target ID | LDTP09104 | |||||
|---|---|---|---|---|---|---|
| Target Name | Sperm microtubule inner protein 6 (SPMIP6) | |||||
| Gene Name | SPMIP6 | |||||
| Gene ID | 84688 | |||||
| Synonyms |
C9orf24; CBE1; SMRP1; Sperm microtubule inner protein 6; Ciliated bronchial epithelial protein 1; Spermatid-specific manchette-related protein 1; Testis development protein NYD-SP22 |
|||||
| 3D Structure | ||||||
| Sequence |
MFLFSRKTRTPISTYSDSYRAPTSIKEVYKDPPLCAWEANKFLTPGLTHTMERHVDPEAL
QKMAKCAVQDYTYRGSISGHPYLPEKYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCC NKYTTYLPRLPKEARMETAVRGMPLECPPRPERLNAYEREVMVNMLNSLSRNQQLPRITP RCGCVDPLPGRLPFHGYESACSGRHYCLRGMDYYASGAPCTDRRLRPWCREQPTMCTSLR APARNAVCCYNSPAVILPISEP |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
SMRP1 family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton
|
|||||
| Function | May participate in intramanchette transport and midpiece formation of the sperm tail. May play a potential role in somatic cell proliferation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
JW-RF-010 Probe Info |
![]() |
N.A. | LDD0026 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Maspardin (SPG21) | AB hydrolase superfamily | Q9NZD8 | |||
| Testis-specific serine/threonine-protein kinase 3 (TSSK3) | CAMK Ser/Thr protein kinase family | Q96PN8 | |||
Transporter and channel
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Homeobox protein prophet of Pit-1 (PROP1) | Paired homeobox family | O75360 | |||
| B-cell lymphoma 6 protein (BCL6) | . | P41182 | |||
Other

