Details of the Target
General Information of Target
| Target ID | LDTP09052 | |||||
|---|---|---|---|---|---|---|
| Target Name | Equilibrative nucleobase transporter 1 (SLC43A3) | |||||
| Gene Name | SLC43A3 | |||||
| Gene ID | 29015 | |||||
| Synonyms |
ENBT1; Equilibrative nucleobase transporter 1; Protein FOAP-13; Solute carrier family 43 member 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPDAGPIGNATGQ
ADCKAQDERFSLIFTLGSFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTTATLIIAFTSA GSAVLLFLAMPMLTIGGILFLITNLQIGNLFGQHRSTIITLYNGAFDSSSAVFLIIKLLY EKGISLRASFIFISVCSTWHVARTFLLMPRGHIPYPLPPNYSYGLCPGNGTTKEEKETAE HENRELQSKEFLSAKEETPGAGQKQELRSFWSYAFSRRFAWHLVWLSVIQLWHYLFIGTL NSLLTNMAGGDMARVSTYTNAFAFTQFGVLCAPWNGLLMDRLKQKYQKEARKTGSSTLAV ALCSTVPSLALTSLLCLGFALCASVPILPLQYLTFILQVISRSFLYGSNAAFLTLAFPSE HFGKLFGLVMALSAVVSLLQFPIFTLIKGSLQNDPFYVNVMFMLAILLTFFHPFLVYREC RTWKESPSAIA |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
SLC43A transporter (TC 2.A.1.44) family
|
|||||
| Subcellular location |
Basolateral cell membrane
|
|||||
| Function |
Sodium-independent purine-selective nucleobase transporter which mediates the equilibrative transport of extracellular purine nucleobases such as adenine, guanine and hypoxanthine. May regulate fatty acid (FA) transport in adipocytes, acting as a positive regulator of FA efflux and as a negative regulator of FA uptake.; [Isoform 1]: Sodium-independent purine-selective nucleobase transporter which mediates the equilibrative transport of extracellular purine nucleobase adenine. Mediates the influx and efflux of the purine nucleobase analog drug 6-mercaptopurine across the membrane.; [Isoform 2]: Sodium-independent purine-selective nucleobase transporter which mediates the equilibrative transport of extracellular purine nucleobase adenine. Mediates the influx and efflux of the purine nucleobase analog drug 6-mercaptopurine across the membrane.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K249(9.09); K255(10.00); K264(4.74); K345(2.28) | LDD0277 | [1] | |
|
ONAyne Probe Info |
![]() |
K249(9.09); K264(9.58) | LDD0275 | [1] | |
|
DBIA Probe Info |
![]() |
C344(0.88) | LDD3413 | [2] | |
|
IA-alkyne Probe Info |
![]() |
C226(2.70) | LDD2182 | [3] | |
|
IPM Probe Info |
![]() |
N.A. | LDD0147 | [4] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [4] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STS-1 Probe Info |
![]() |
N.A. | LDD0136 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C226(1.54) | LDD2187 | [3] |
| LDCM0572 | Fragment10 | Ramos | C226(2.76) | LDD2189 | [3] |
| LDCM0573 | Fragment11 | Ramos | C226(2.12) | LDD2190 | [3] |
| LDCM0575 | Fragment13 | Ramos | C226(1.07) | LDD2192 | [3] |
| LDCM0576 | Fragment14 | Ramos | C226(1.28) | LDD2193 | [3] |
| LDCM0580 | Fragment21 | Ramos | C226(1.13) | LDD2195 | [3] |
| LDCM0582 | Fragment23 | Ramos | C226(0.96) | LDD2196 | [3] |
| LDCM0578 | Fragment27 | Ramos | C226(0.85) | LDD2197 | [3] |
| LDCM0586 | Fragment28 | Ramos | C226(1.11) | LDD2198 | [3] |
| LDCM0588 | Fragment30 | Ramos | C226(0.63) | LDD2199 | [3] |
| LDCM0589 | Fragment31 | Ramos | C226(0.66) | LDD2200 | [3] |
| LDCM0590 | Fragment32 | Ramos | C226(1.98) | LDD2201 | [3] |
| LDCM0468 | Fragment33 | Ramos | C226(0.61) | LDD2202 | [3] |
| LDCM0566 | Fragment4 | Ramos | C226(2.52) | LDD2184 | [3] |
| LDCM0610 | Fragment52 | Ramos | C226(0.68) | LDD2204 | [3] |
| LDCM0614 | Fragment56 | Ramos | C226(0.69) | LDD2205 | [3] |
| LDCM0022 | KB02 | Ramos | C226(2.70) | LDD2182 | [3] |
| LDCM0023 | KB03 | MDA-MB-231 | C226(2.64) | LDD1701 | [6] |
| LDCM0024 | KB05 | RVH-421 | C344(0.88) | LDD3413 | [2] |
The Interaction Atlas With This Target
References







